Opitutus terrae PB90 1 uid58965

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|182411938|ref|YP_001817004.1| glutaredoxin [Opitutus terrae PB90-1]
    MPAELPILYVKTGCPWCHEAIDFLSEHGIGYREQNVSDDPRAMEEMRKKSGQTRAPTLDWNGKILADFGVDELIPFLRQQ
    NVKLEDS

    >gi|182411962|ref|YP_001817028.1| redoxin domain-containing protein [Opitutus terrae PB90-1]
    MRHFCSLLLAFTLTASLALAADRTPLAIGSDLPDFKLRGVDDRDYTPRDFADAKVLVVIFTSNHCPTAQLYEHRIKQIVD
    DYRPRNVAFVAINPNHADAVRLDEMAWTDLDDTHEAMKIRARDHAFNFPYLDDGETQAVAEKFGAVATPHVFIFDQARKL
    RFQGRVDDSEREGLVKQRTTRDAIDALLADREPSVKTTKVFGCSIKWKEKAEDNRRWREKVAKEPVELTRADAAALRELR
    ANKGTGKVRMINVWATW
    CGPCVSEFPELVEHNLRFRSREFELVTLAAEFPDIEPKVLKFLQKQQASTRNLIFGTTDKYAL
    MEALDPEWNGALPHTLLIDPEGKVIYRETGAIDFLALRRTLLKALDAISPWPATGGQ

    >gi|182411969|ref|YP_001817035.1| OsmC family protein [Opitutus terrae PB90-1]
    MKRTATAVWNGSLKTGHGALTTPGGALKSTPYSFSSRFESGTGTNPEELIAAAHAGCFAMALSVELGKAGLAPERLEARA
    EVNLENVPPNGWTVTTSHLVLKAQVPGVDAKKFSEIAEQAKAN
    CPISRLLTAKITLDASLA

    >gi|182412091|ref|YP_001817157.1| peptide methionine sulfoxide reductase [Opitutus terrae PB90-1]
    MKRLFTLLALAGLVFPMAHAAETKTESIVLGGGCFWCTEAAYELLPGVKNVVSGYAGGHQPNPNYEQVCGHGTGHAEVIK
    IDYDPAQVSLDEVLDYFWHVHNPTQVGGQGNDRGPQYRSIILYANEAQKTAAEKSKAKAAEEFRDPITTEIVPLEKFWVA
    EDYHQDYFRKNPNQGYCALVIAPKIRKLQKQVSAAGK

    >gi|182412125|ref|YP_001817191.1| methyltransferase type 11 [Opitutus terrae PB90-1]
    MPTEHAVKQRYAAAAKAPEAALCCPVDYDRRYLEIIPAEVIEKDYGCGDPSRYVKPGETVLDLGSGTGKICFIAAQVVGP
    QGRVIGVDMTDEMLEVARRNAPVVAERLGYANVEFRKGRIQDLALDLEQLDRELARRPISDATSFLAAQDLADELRVRAP
    LVADGTIDVVVSNCVLNLVEPRAKRTLFEQISRVLRRGGRAVISDIVADEPVPDALQQNPELWSG
    CISGALTEEEFLQAF
    ADAGFHGIQMLKRDTAPWRTVEGIEFRSVTVQAFKGKQGPCLERNQAVVYLGPFKEVLDDDGHRLVRGRRHAV
    CDKTYRL
    YQQEPYRTHFAAIDPLHEVPLTDAKPFDCAGARLRHPRETKGQDYDATTTAAQSRAGGCC

    >gi|182412129|ref|YP_001817195.1| radical SAM domain-containing protein [Opitutus terrae PB90-1]
    MISFDQKLAAHGLTLTRRSVQTLQINVGRKCNQACRHCHVDAAPWRTEMMDATVAARVCEWIRAHRPEVVDITGGAPELS
    EHFRTFVETARDCGCRVIDRNNLTIIETPAFAWLPDYLAAHEVEVVASLPCYSAENVDAQRGEGVFAKSIRALRKLNAVG
    YGTRLPLSLVYNPLGAKLPPPQPELEAEYKAELRTRFGIEFTRLFALVNQPIARFAQDLREHGEWDAYLELLANSFNPAT
    VDGLMCRSTLSVGWRGEIYDCDFNQMLGLQLRNGKALHLWGVTPAYLAGGAILTGAHCLACTAGAGSS
    CTGALN

    >gi|182412133|ref|YP_001817199.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Opitutus terrae PB90-1]
    MKHPPLLQPWDEHNRRLQAHVHPSDWKSPTPAPRYNLVVIGGGTAGLVTAAGAAGLGAKVALIERHLLGGDCLNVGCVPS
    KALIRAARAAAEARASARFGVKITGEVAVDFSAVMERMRRLRADLSPHDSAARFRELGVDVFIGEARFASGDTVQVGGQA
    LRFAKAVIATGARASAPPITGLAEVPYLTNETLFSLTELPRRLAIVGAGPIGCEMAQAFARFGAEVTLIESAAGILPRED
    REAAEILRAALERDGVRILCDGRDLKVARAPDDGVIWQLASAGQQQAGHADRLLVAVGRAPNVEGLGLEAAGIAFGRQGV
    KVDDFLRTTNRRVYACGDVCSRFQFTHAADFMARIVIQNALFKGRRRVSALTIPWSTYTSPEVAQIGLGPADAKVRGLAM
    DTFTQPLAKVDRAILDDEADGFVRVHVRRGTDQIVGATVVAAHAGDTIGELSLAMTNKIGLGRVGAAIHPYPTQAEAIRR
    VGDLYSRTRLTPWVKRVFSWWLAWQRAEFGQRRSPQARPHPLMAP

    >gi|182412320|ref|YP_001817386.1| redoxin domain-containing protein [Opitutus terrae PB90-1]
    MNLSRLAFPVLLVAAAVLTHAQAAPVPPTPAPDWKLKDLMGAEVSSEQFKGKVVVVDFWATWCGPCRMEIPGYVALQKKY
    GRDKLAIIGMSVDRGPDVVKKFVAANKVDYQIVMANDDVVQAFGGDEGINAIPTTFIIDRTGQIRDRKLGAEPTEEFEKR
    LATYLK

    >gi|182412595|ref|YP_001817661.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Opitutus terrae PB90-1]
    MLRCQQRERSTAAPRSPGDIVATDSGELHDVCIVGAGPAGLNAALILGRCRRDVVVIDSGKPRNGASRALHGFLSRDGTP
    PLELRALGRAELEPYPSVQLRQNTAVVAARRGENRFDLTLADGSTVAARILLLATGRIDLVPEKPGFREYYGLGVFH
    CPY
    CDGWEHRDETLVAYSSGETGHDLALDLRVWSRDVVLCTDGPSGLTPAQLRKLALNGVRVIEAPVVGARGGTGGVIASIVF
    EGHPELSCGAIFFSSDCLQKSPLAEELGCDLDDTGSVRCTGHAATQVPGLYVAGNVRGGVHLAIVAAAEGAEAGMAINNA
    LHEADLK

    >gi|182412715|ref|YP_001817781.1| glutaredoxin [Opitutus terrae PB90-1]
    MKIKAYLKPSCGWSNGVRAILRKYNLPYEDIDIINNRTNYAEMVAKSGQPLSPCVEIDGVMLADVSGEEVENYLLSNELI
    QPVDAPMDVATNAGCSDDEHARMATKTIRFF

    >gi|182412719|ref|YP_001817785.1| thiol:disulfide interchange protein DsbD, putative [Opitutus terrae PB90-1]
    MVPHMSAFCSFAPNWLRLRLLVGLIALGWLQTATAALPSPETHVQGSLVSADASIQPGRPFTVALRLEHEPHWHTYWLNP
    GTGLATTLAWKLPAGFTAGDIQWPAPIVLKDRSGTVVGNGYEGETLLLVTITPPATLATGTEVRLEADAEWLMCSDVCIP
    GGQALSLTLPVRGDPPSPNPPWHEKIAATAAGLPRPPEQWKVTASRDEKNITLHITPTADRPTQVPEQLHFFADDNLVAY
    ELPQTTQPAGTAGSARVGFILTAPVSPDGPQNATELRGVLTSENGWRADGSMRGLRIDVPLTVASTAPGASLSTAERGAP
    TPGSTAAAVTPANSGLLATLLLAFVGGLILNLMPCVFPVLGIKILGFVNQAGHARSKVVAHGLVFTLGVLLSFWVLAGAL
    AILRAGGDQLGWGFQLQSPAFVFSLTVLLLVFAMNMSGVFEFGLRATSVGGELQTKSGLAGSFFTGVLATVVATPCSAPF
    LAPALGAALALSTIESFTIFTAIALGLATPYLLLSIFPGAVKILPRPGAWMEGFKQFMAFPLYATVAYLVWVLAGQVSEE
    GFQQVLFGLVLVALGVWIYGRWSMPGASPARVRSGATALVLVAALGLWLGWPQATLTQTPGSVTSAGVAWQPWSPEAVQQ
    LRAEGRIVYVDFTARW
    CATCQTNKKLVFHSDEVLQTFAHKKVAALRADWTNKDPRITAELARYGRSAVPFNVIWLPGRNE
    PVILPEILTPGTVLEALQSETVAVQ

    >gi|182412920|ref|YP_001817986.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Opitutus terrae PB90-1]
    MKSTRLRFLSILAVATLGLATSAFAGDMAQSDHAMAMMPMKQLGVGDHVPAVTVLDEASRPHDLAALVREKPTVLIFYRG
    GW
    CPYCNMHLAALVGIEDELRAAGYQLLAVSADQPMKLRETPDRGKIHYQLFSDQEMKAADALGISFEVKPDDVRMFKEK
    YQIDLEAASGRTHHKLPHPAVYVVDTSGTIRFAHVNPDYKHRLEPQKIVAAAKDAAMMTTAKM

    >gi|182412973|ref|YP_001818039.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Opitutus terrae PB90-1]
    MNLRTTSLFALMFLSTFLSVFARSQPLKVGDEAPAVSGTTEAGTPLAFADVYKQQPYTLVYFYPKADTAGCTKQGCSLRD
    AYETLAKKGVAVIGVSHDDVAAQKAFKEKYQFPFTLIADTDDTVLKAFGVPHIPATQLATRQAYLIKDGKVVWADYSAST
    EQQAADVLKVLDEQKS

    >gi|182413039|ref|YP_001818105.1| heavy metal transport/detoxification protein [Opitutus terrae PB90-1]
    MQPVKQSWILTGGFLSAVAASLCCIGPLVAAVAGAGSFVAAGWFERWRPAFLGVTAALLALAWVLTLRARRIACADGTCA
    TPRASRWTLGVLIFSTVIVGAVAMFPQLAQTTFGRSSVATSAPADGRVLRVRIPSMD
    CAACAVGIAGTLQRVPGIRTAVV
    RYATKEAEVVYDPAVISATTVIAKIDATGFKAEPAN

    >gi|182413100|ref|YP_001818166.1| alkylhydroperoxidase [Opitutus terrae PB90-1]
    MFLLNEMDELWEQFSSKAYRPNVLDGKTKEIIAVSASVVADCLPCLEYHYKRAVKAGASREEIAESIAIAMSISAGSKKA
    KYFPVISRLENEQASAVGPA

    >gi|182413137|ref|YP_001818203.1| redoxin domain-containing protein [Opitutus terrae PB90-1]
    MSTTEKKTFTLELGSTAPAFRLPATDGKTYGLEDFQDARVLVVFFTCNHCPYVTGSDESTRQTAQRFAAQDVRFVGINSN
    SERTYAEDSFGHMGERMKQHRFPWVYLRDETQDVARAYGALRTPHFYVFDAQRRLVYTGRGVDSPRDPSRITVNDLANAL
    EDHLAGRPVRTPKTNPIGCNVKWEGKDAHWMPADACDLV

    >gi|182413250|ref|YP_001818316.1| rhodanese domain-containing protein [Opitutus terrae PB90-1]
    MKFVARLVALFALTALAAHAGEVANVTPAEAAQRVAAGQAVLVDVREPNEWADTGVAEPAVLLPMSDFNGEQKLWKPFLE
    KNAGKELILY
    CRSGSRSGKVAAKLAAQGQPVANAGGFRDWKSAGLPVRKP

    >gi|182413264|ref|YP_001818330.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Opitutus terrae PB90-1]
    MSSPRRIPYGRLVLFALGALGAIFVINRLGARGSASAANSVPADQRSAAPAFSVTTLDGTPWSLESQCGKVVLVNFFATW
    CPPCRAEMPDLVKIAQDYRPKGVETIGLSLDEGGADVVQPFLKRYRVDFPVGLPEPGSAITAGITGIPVTLILDKSGRVA
    RHYVGMISEEQVRGDLDALLAE

    >gi|182413270|ref|YP_001818336.1| thioredoxin [Opitutus terrae PB90-1]
    MAHDLSDFQTDIIDQSQRTPVLVDFWAAWCGPCKMLGPVLEKLAGEAAGRWMLVKIDTDAHQDLAAQFGIRGIPNVKLFH
    HGEVIAEFAGALPEPQLRAWLNEHLPTPKREGMARARELLRAGRGAEAAAALQPLAAAEPQDAELAVLLARATMFDHPKQ
    AAARVSHLPAGHAWTDDAEIVRAITAALHTLQHDSDRLLASPLRDIYLVALRDLQSQRFREAAQGLVSVLQEKPNYDDGR
    AKAACLAVFKHLGMRHPITEEFSRAYSMAVNV

    >gi|182413271|ref|YP_001818337.1| rhodanese domain-containing protein [Opitutus terrae PB90-1]
    MSFLTMLSSLFKPAPRATPTEYGAKIRSGDALLIDIRESDEWTGGVAETAALLPISELRAPSAAWRDFLAKAGQREVLLY
    CASGTRSAMAVRHLLSQGVRALNAGGLADWAAAGWPIVKPK

    >gi|182413281|ref|YP_001818347.1| protein of unknown function DUF395 YeeE/YedE [Opitutus terrae PB90-1]
    MNPYWAGFALGLVLLTAFVVMGRGLGASGAFTTAVATTVHAVAPAHAEGNAFYQEYLGDGTTSPLKDWLVFQVLGVFVGG
    FLSGALAHRLKVTVEKGPRATTALRLVLAFVGGALMGIGAKLALG
    CTSGQALTGGALLNVGSWAFMMCVFAGAYGLAWFF
    RRQWL

    >gi|182413408|ref|YP_001818474.1| methyltransferase type 11 [Opitutus terrae PB90-1]
    MAETILPDIEQIRNFVRERYGAIAEQADETCGCSATGCCGGTKENYGEKLGYSAEQLAAAPAGSDLGLGCGNPLAIASIR
    PGETVLDLGSGAGFDCFLAARQLNGTGRVIGVDMTPAMITKARANAAKSGFANVEFRLGEIEALPVADTSVDLILSNCVI
    NLSPEKARVFREAFRVLQPGGRLAIADVVALKPLPAEMKAKLSSIGA
    CVGGATLVDELRQLLTAAGFERIEIVPKESSRA
    YIAQWTDDASAADFVVSAFITAYKAQK

    >gi|182413430|ref|YP_001818496.1| redoxin domain-containing protein [Opitutus terrae PB90-1]
    MSFPSSTFPAAFARGLRGGFVALVFALLGLPGLARAQIAVGDAFPNLATMGLTEGKLPDSAGRVMLVDFWASWCAPCKAS
    FPAFSRLHTAFAEKGFVIVAVSVDEKPAAYAAFVKKWQPPFTTVLDQAQNLVRAVKVPAMPTSYLIGRDGRVRSIHQGFH
    GAATERELQQSIEKLLAEQA

    >gi|182413448|ref|YP_001818514.1| hypothetical protein Oter_1630 [Opitutus terrae PB90-1]
    MPNALAQEKSPYLLQHADNPVNWLPWGEAAFAKARAEQKPIFLSIGYATCHWCHVMAHESFENEAVAQLLNESFVAIKVD
    REERPDVDRVYMTYVQAMTGHGGWPLSAWLTPDLKPFFGGTYFPPEDRQGRAGFAAILRAIAHGWSTEREKLVAEGERVI
    AALREHQQSKTADVSKSTGGESAGAEIGSGIDALIHQLHERGAPAFERGFQYFYEAFDPEHGGFGGAPKFPRASNLSFLF
    RAAALQGVASEAGAEAIRLASATLQAMARGGIHDHVGGGFHRYSVDERWFVPHFEKMLYDQAQIALNALEAKQATGDERF
    AWLARDILTYVLRDLAHPDGGFYSAEDADSAAANAEPGHGGKKVEGAFYVWAQSEIEQVLGDEARLVCEHFGVKPDGNVP
    GQLDPHGEFTGKNVLAQAQPLATTAKAHELTPEMASERLQAALERLRAVRAQRPRPLRDDKIITAWNGLMISALAKAHVV
    LELAEDAAETLYLGAATRTAEFVERELFDRDRAILFRSWRGGRSAVEGFAEDYAFMIQGLLDLYEAGFDVRWLQWAERLQ
    ATMDARFWDAEHGGYFNSASDDPHLVLRLKEDYDGAEPAPSSVAAMNLLRLGVMIERPGAAAAAGGIDYRERGLRTILAF
    QEQWSQTPQALPQMLCALERALMPPAHVVLAGQPGDEAFRALLRVVQGRLGSQHVLLVADGGEGQRWLSARAPWLTTMTP
    RNGQATAYVCEDFTCQAPVESPAALRDLLTR

    >gi|182413596|ref|YP_001818662.1| methionine-R-sulfoxide reductase [Opitutus terrae PB90-1]
    MKPLAPFSLFAIAVVAAATQPEMKSMKPAENSADPAACAINAEKSACGLPSHVVIDMSKTKVQRSEREWKKLLTPTQYRV
    ARQQGTEPPFRNEFWDNHQDGVYFSVCSDTPLFDSRDKFESGTGWPSFTKPIEPAFVGENRDVSYGMVRTEVHCNVDGAH
    LGHVFDDGPRDKGGLRY
    CINSASLRFMPRKDYEAWVAKNQGTMAAK

    >gi|182413794|ref|YP_001818860.1| rhodanese domain-containing protein [Opitutus terrae PB90-1]
    MNPKFSAYAHPEVLVDGDWLQGHLHDPGIRIVESNEDLLLYDTGHIPGAVHIDWRGDLQDNTQRDYVSPERFAEVCSRNG
    ITPDTTVVFYGDKSNWWAAYALWAFRLFGHTKVKLLDGGSVKWKAEGRPITRDKPNVTPTNYPVPPKRHDDVIRAFYTDA
    LEHSRGRKPLIDVRSPGEYRGEITHMPEYPQEGVLRGGHVPGARSVPWGTAVNSDGTFKTFDELKKIYTEQLGLKKNDDI
    IAY
    CRIGERSSHTWFVLSYLLGYERVRNYDGSWTEWGNMVRSPIAKGEQPG

    >gi|182413894|ref|YP_001818960.1| electron transport protein SCO1/SenC [Opitutus terrae PB90-1]
    MRRSVLVSILAAWGVVVLAGCGRSETAAQAKPEPGYPLTGEIVEVNPAENVLVVRHDDIPGLMPAMTMEFTATPGDVALA
    KPGQKIRARLIKAGEGDWRLERIWPMDPAQVKEIEARANALRQETLARGRGVYREIGEKMPEFALYDQEGRVVQSGRFAG
    KQVMLNFIFTR
    CPVATMCPASTAKMGIAQKLAREAGVTNLELVSITLDPAYDTPGVLKEYATTRGIDTSNFSFLTGPENA
    VRDLLAQFGVLAEPDKDDLVKHTLATILIDEKGRIVHRTDGSSWDPKEFVPKMKRG

    >gi|182413912|ref|YP_001818978.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Opitutus terrae PB90-1]
    MKTRILFACGCLGLGGAVATAAESSVAPAAVSAPAASVSTVQDELRTLVEKVRAKLSSGVRTEAALAEELKAFDALLAAH
    ASEKTDEVAQVLLMKAMLYLQVFDDADRGAELLTQLKRDFPTTQLAGKVDEVLQQIEQQRESAALRAKLKPDAVFPDFTE
    QDLNGAPLSISGLKGKVVLVDFWATW
    CGPCVAELPNVLAAYGKYHDKGFEIVGISLDRSEDALKKFIAEKQMTWPQYFDG
    KAWDSKLGRQYGITSIPATFLLDRDGKIIARDLRGKELEAELAKALGE

    >gi|182414074|ref|YP_001819140.1| vitamin K epoxide reductase [Opitutus terrae PB90-1]
    MPPHESPPRPRSLRAWPWWRWALTALSALGLALSSYLSWHALAGGAMLGCGGGSPCDDVLNSRWSMIAGILPVSGLAAGA
    YLAMLVCSLAIGPANPAPVRRLAWDALQVLTGAAAGSAVWFTIVQKWIVGAFCPYCMATHLTGLVLTVLVIWRVLRAAED
    DFTDAPVVAGIAAPGRPQRGQLPPHARTSGFRLSVLRRLSPVLIGVALAAILVAAQIALAPTSMYRGGESQNQPAALDPH
    AVPLVGSPDARYIVTLLFDYQ
    CAHCQQLHLMLSEAVRRYEGQLAFALCPAPLNTRCNPYVPRDVDEFKDSCELARIALTV
    WRADRTAFPAFEDWMYTFDSGDRWRPRTVTDATTKAIELVGRAKFDAASNDPWIDRYLQASVRIYGDTMQNGIGGVPKLV
    FGPRWVSPQPRDAADLVSILQTRLGLPHPAPAPSPTVH

    >gi|182414086|ref|YP_001819152.1| arsenate reductase and related [Opitutus terrae PB90-1]
    MPEPLVVYTYANCSTCRDAVKWLRAHAIAFEEKPIYETPPSVPELRRMLARQSGELRRLFNTSGLSYKALDLKTKLPQLS
    EAQALELLASNGRLVKRPFVLGDKVGLVGFKPEAWAAALARA

    >gi|182414467|ref|YP_001819533.1| iron-sulfur cluster assembly accessory protein [Opitutus terrae PB90-1]
    MITLSTRAAERVRSMQAELNAPSKKLRVFVESGGCSGLQYGMSFDEPKPDDAVVESEGVPILLDPASATYLSGSTIDFDD
    GLHGKGFEIKNPNAGSTCGCGKSFS

    >gi|182414477|ref|YP_001819543.1| methylated-DNA--protein-cysteine methyltransferase [Opitutus terrae PB90-1]
    MGRTTFTTEFGCCAIAWSDQVLTGFELPEAQPAAADVAPPPEIAAIIARVQRHLSGDLQDFSRLPFDFHLVPAFNADVLQ
    ATLQVKPGQTCSYGEIAARLGYPPATSRAVGAALGVNRWPLLIP
    CHRIVGADGRMTGFSGPGGVKQKLRLLALEGAQLLA
    E

    >gi|182414499|ref|YP_001819565.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Opitutus terrae PB90-1]
    MPLAIGSQAPDFTLKSKTADGLKDVRLSENFGQRQTVLLFFPLAFTGVCTQEMCDTSAGLSDYEKLGANVIAISVDSPFA
    QEAWAKANRIGVTLASDLNKQVIKAYDVVFPNLAGVGDTAARAAFVVGKDGVIKYAEQTPTPKDLPNFDAIKAALNR

    >gi|182414527|ref|YP_001819593.1| dihydrolipoamide dehydrogenase [Opitutus terrae PB90-1]
    MAETVEYDLVVVGGGPAGYAGAIRAGQLGKRVACVEMERAGGTCLNWGCIPTKALLKSAELYQKMKKPETFGLSVKEVGF
    DFAKVMERSRGVAGQMAKGVEFLFRKNKVDYIVGRATVPAAGMVEITEGEQKGKFLKAKNVLIATGCKMRRLPDLPVDGA
    RVMTSREALASKTLPKSIAIVGAGAIGVEFAYFYNAFGTQVTLVEMLPQILPVEDEEVAKLLHRAFEKQGIKIHVGTKCE
    NFRVGKDSVKLNLVKGDKTEEIEVETVLSAIGVVANIEGVLGKNLKVELDRNYVKVGDDYQTNVKGIYAAGDIVGPPWLA
    HVATFEAVSAVNGMFGHGKPERVKNFPGCTYCQPQVASTGLTEKAAKEKGLAYKVGKFPFTASGKAVASAESEGFVKVIS
    DAKTGEIYGAHIIGAEATELIAEYGLAVHLEATVEEIHQTIHAHPTLSEAVMEAAAATSGEAIHI

    >gi|182414561|ref|YP_001819627.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Opitutus terrae PB90-1]
    MKFDFDFLVLGGGSAGFNAARVAADLGLKTAVVDGARHLGGLCILRGCMPSKTLLYVAEVLHLAQKAKVFGLRIPSATPD
    MKAIHARKKKIIADFASYRAQALESGQFELIRANGSFVDPHTIELSDDRQLRAKHMLIATGSKVSVPNVPGLADTPFWSS
    DEVLDLDFVPESVLVLGGGIVACELAQFLRRIGSRVILVQRSLNILRDHSAAASAVVEQALRDDGIELFTGTHLQRVWSD
    SRGVNVEFLCNGKVRRRRAAHLFNALGRQANTTSLNLRAAGIRPRITGQIPTNRWQQTRVPHIYAAGDCAGPVEIVHVAI
    QQGDLAARHAAGIRKLKPVDYSLLLNVVFTDPQLATIGRLERDLERHGRKFLVASYPFNDHGKSILMEANYGYVKVIAEP
    RRGRILGAEIVGKDAGELIHAFSAPLAMRATVFDLLRAPWYHPTLAEIITYPLEEIAEQVKR

    >gi|182414795|ref|YP_001819861.1| heavy metal transport/detoxification protein [Opitutus terrae PB90-1]
    MQPVKQSWILTGGFLSAVAASLCCIGPLVAAVAGAGSFVAAGWFERWRPAFLGVTAALLALAWVLTLRARRIACADGTCA
    TPRASRWTLGVLIFSTVIVGAVAMFPQLAQTTFGRSSVATSAPADGRVLRVRIPSMD
    CAACAVGIAGTLQRVPGIRTAVV
    RYATKEAEVVYDPAVISATTVIAKIDATGFKAEPAN

    >gi|182415282|ref|YP_001820348.1| methylated-DNA--protein-cysteine methyltransferase [Opitutus terrae PB90-1]
    MSSIFYDTFTTPFGDFSAAVDDAGNVVATAFGDLAALRQRLRSSRRCSLAGRGVPAEPAVSAAHRDGSPYRSLARNPAVH
    AAGHEMSRDAEWVSDQHRTGAVREQVGEYCGGARQEFDLPLAPTGSAFQQRVWTALRAIPFGTTCSYAQLAARLGLSGGA
    RAIGGANAANPICLIVP
    CHRIIGSNGALTGFAFGEERKRALLEHERAATLAASRAPAVPQAACRA

    >gi|182415342|ref|YP_001820408.1| UBA/THIF-type NAD/FAD binding protein [Opitutus terrae PB90-1]
    MPESLPELSPAELARYSRHLLLEQVGLAGQRRIAAARVLVIGAGGLGSPAGLYLAAAGIGTLGIADLDRVEAHNLQRQLL
    HDTASVGEPKVSSAARRLRGLNPHVRVVEHASGVTTENAPGLFANYDVIVDGTDNFDARYMNNDAAFHAGKPLVFGSVFK
    FEGQVAVFDPAHDGPCYRCLFPEPPASGSVPG
    CGEAGVLGALCGVIGSLQALETIKLVTGVGAPLRGKLLTYDALTQTFQ
    TLALARNPSCPLCGDGAIAPAAQLPPRAPDAPREISAAEARHRLDTTPEQTLLLDVREPWETEIVRIAGAEHIPMRQVPA
    RLSTLPKDRDLLVL
    CHHGSRSRQVSEFLRAQGFPRAINVAGGIAAWTDEVDPSLVRY

    >gi|182415459|ref|YP_001820525.1| hypothetical protein Oter_3648 [Opitutus terrae PB90-1]
    MPETATARSGIRALPAMRGRLAFRWIAVISAVLASLPMPTRAAVPGQMQSVTAAALAWETLEQSYDAKPGETTAEFSFAF
    RNVSDAPVEVRGISTS
    CRCTAGIMRAQPWIIAPGASDTLRVIVDLRSRRGALTKTVYVDTTAGEELLLVHVQVPTPPAIQ
    REMNMMVAQADRQAVLRGDCVSCHVTPAAGRMGGELFQAVCQVCHGAEHRASMVPDLKAPPTVRRDGAYWNEWIRNGKEG
    TLMPAWDKKRGGVLDDAQIESLIAYLLANLPSEPAPAAPLPTPAN

    >gi|182415488|ref|YP_001820554.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Opitutus terrae PB90-1]
    MTSNCCNGDIRIGFYICHCGHNIGAVVDCPAVAQAVAKLPGVVVSRDYKYMCSDPGQELIQQDIREHHLTRVVVASCSPL
    LHEHTFRHAVAAGGLNPFHFQMVNIREHDSWVHTDRAAATAKAKALARAAIERVRFHRPLETTRVPINPDVLVVGGGISG
    IHAALTLGNANKHVYLVEREPSIGGHMAKFDKTFPTLDCAA
    CILTPKMSAVRAHENITLWTYSEIVKVEGYVGNYTVTVR
    RKPRYIDEELCVGCQECIKTCIFKDGKFPDEFNVGLSKRKPIYIPFPQAVPQVVVIDPERCLQLKTGKCKMTCLDACTDR
    KAINFEQMERLETIKVGNIIVATGFKLFDAKRIPQYGYGAYPNVVTSLELERLVTSSGPTGGEILLKNGQPPKSVAFILC
    VGSRDFRTNRWCSRTCCMHSMKLAQLVREHTDADVTVFYMDIRAPGKGCEEFYDKSLRDGIQFVRGRVAEVTDWALVPEE
    EGKLVIRAEDTLAGLVRRIPVDMIVLAVGMEPQSDAQEVRRLFNMSCGTEGWFLEKHPKLAPVSTFTDGVFIAGCCQGPK
    DIPDSIAQAGAAAAEALALIDRGYIEQEPNTAYIAAEECSGCKSCIGLCPYTAITFDETKQVASINAALCKGCGTCVAAC
    PSGSIHQNLFEDQQVFSEIAGVLAD

    >gi|182415538|ref|YP_001820604.1| alkylhydroperoxidase [Opitutus terrae PB90-1]
    MEERLNYAEASPQGFKAILGLERHVRESNLEHRLLELVKTRASQLNGCAFCLDMHTKDARAAGETEQRLYALSAWRETPF
    FDERERAALAWTEAVTQLHPQHPIPDAVYAEVRPHFNDRDLVDLTLAIIAINGWNRLAIAFRKTPGSYQPPSTAPAAVTA
    KA

    >gi|182415657|ref|YP_001820723.1| thioredoxin [Opitutus terrae PB90-1]
    MSEKIAQLTAADFESAISSGTTPVLVDFWAPWCGPCKAIAPILEELATELDGKLKIAKVNVDDHGEIATRYSIRAIPTML
    LFKGGQVAEQLVGMMPKATLKAKIAAHV

    >gi|182415690|ref|YP_001820756.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Opitutus terrae PB90-1]
    MKTFRALLLAASVGSVALVSQAMAVVTIGAPAPDFTLNDINGRTHKLADYRGKIVVLEWVNSGCPFVQKHYHSGNIPRLQ
    QSATSDGVVWLAINTGRDGTQGALASGAASRWLQEQKAAPTAYLRDQDGTVGRLYGAKATPHLFVINADGVLVYNGAIDS
    IRSADLEDIGRATNYVSAALADLKAGRPVATAATQPYGCAVKY

    >gi|182415855|ref|YP_001820921.1| OsmC family protein [Opitutus terrae PB90-1]
    MVKITGEYQGDLRCVAIHGPSGQSLNTDAPKDNQGRGEEFSPTDLLATSFATCIATTMAIVARRHGIELQGLKFAVTKEM
    SADGPRRVARLATELWLPIAKTPDVEKLLKNTALG
    CPVHHSLHPSIDAPITFHWAGE

    >gi|182415859|ref|YP_001820925.1| OsmC family protein [Opitutus terrae PB90-1]
    MKTIHIAEMIAQGGRDGSVEAPEGSFAVQLSTDEKPESVTPEHLFAGAYGSCFLGALKNAAETAHLPTEGFTVLARAHLE
    EDRRGGYNLNVELRAAMPGISESDARHVLNLAHQT
    CPYSKATRGNINVSLAFD

    >gi|182415867|ref|YP_001820933.1| thioredoxin domain-containing protein [Opitutus terrae PB90-1]
    MRIALLMFTLLCGAALLHAEETKPAPAPPALPRLLDLGAGKCIPCKRMKPILAELTREYADQFTVVFIDVWEDNAAAEPY
    GIRLIPTQIFYAADGQELFRHEGFYGKKEILAKWRELGVALKEPATAKNE

    >gi|182415869|ref|YP_001820935.1| redox-active disulfide protein 2 [Opitutus terrae PB90-1]
    MKKIQILGTGCAKCQKLAAVADEAAKSLAVPYELEKVTDLKQIMSFRVLSTPALVVDGVVKLSGRVPTLDEARQLVR

    >gi|182415890|ref|YP_001820956.1| copper-exporting ATPase [Opitutus terrae PB90-1]
    MSSGTIDGAAAPPPRPNAPRRPAKPTCAHCGAPLVDVRMQESGFCCSGCAYVYRLVHEHGLAGYYNIKDEITAPADDSVF
    EPRDFSWLASAQREAEAAAGAATPSSRPTPLPPELTLDVQGIS
    CAGCVWLIEKVFAQQPGARDIEANAQLGQLQIRWIPP
    KFSVVEFARKLQSFGYLLGPAGDTGGVPESRGLVKRIGLCAAFAMNVMLFAFPAYFGMEPSFEYARLFGLLTLAFGTLSF
    LVGGVYFVGRAFRALREGAMHIDLPIALGILGAYGGSLYGWFAREERFVYFDFVATFILLMLVGRWAQVAAVERNQRRLL
    SQQPKPQRVALVVGGELPPEQLQAGQDYFAAAGQVVPVESRLISAEAAFSLASITGEPEPRSFLAGQRVPAGAINVSRTR
    AELSATQPWADSLLAQLLQPHVRAGARHALLEAIVRGYLIAIIVLAVGAGIAWWMISHDALRTWSVVTAVLVVSCPCAIG
    LAFPLADEIATVALRRRGVFVRNGDLWPRLGRVRKLVFDKTGTLTLEMPVLLNPDALRSLDAEARSALHALVRDNPHPVS
    QCLLANLLSLPSFGSEKSNPLGYSSTDAFPEIRETISQGVEFVQRGHRWSLGRVGWRSPVAVEERDEEKSNPLGYSSSRG
    YDTELAVDGHMLARFQFADMARPDARAEIAALQAAGAAVFILSGDRPEKVSALAKELGLPAAHALGHLTPQEKATWIEAH
    GRDETLMLGDGANDSLAFDQALCRGTPVIHRGILAPKSDFYYLGRGIAGVRALFAVNALRRRTQIIILLFSVLYNALAVG
    LALAGHMNPLVAAILMPANSLLTLALVTGGMRRAFAR

    >gi|182415973|ref|YP_001821039.1| thioredoxin reductase [Opitutus terrae PB90-1]
    MSSSVENVVIVGTGCAGLTAAIYTARANLNPLVLEGTLPGGQLTTTSEVENFPGFPEGIDGFQLMQNLREQATRFGTRFE
    QALVTAVDFTSQPRKLICGDRTVLAKTVIIATGASPRMTGVPGEKELYGGKGVTT
    CATCDGAFYRNMDVAVIGGGDSAAE
    EALFLTRFASKVYLVHRRDTLRASKIMAARATSHEKIVPVWNSIPLAVEGVEQGGVSGLRVENVKTGETRVLPVKGVFIA
    IGHVPNSGPFAEALDVDEGGYFKPSVGSQVKTKVPGVYVAGDCADHVYRQAITAAGMGCQAAIEAERWLAEHGT

    >gi|182415999|ref|YP_001821065.1| dihydrolipoamide dehydrogenase [Opitutus terrae PB90-1]
    MSSASFDLIVIGAGPGGYVCAFRAAQLGMKVALVDKRPTLGGTCLNVGCIPSKALLHSSEHVTWAQHHAAEHGIKLGQVE
    LDLEAFMKRKDEVVAKLVGGVAQLAKARKITVVHGAASFLDRNTVAVAGVADPGQPGSTSPATSRQTLTAPNIVIATGSA
    PVELPFLKFDGKTIVSSDHAIAFASVPKKLVVVGGGAIGLELGSVWSRLGSDVTVVEFLPKIVANYDDDIVRNFSRILTK
    QGLKIETGAKVTGFRPSTAGATGILTAERDGKKLEFEADKVLVSVGRHPFTDGLALEKAGVQLDEKKRIKVDDHLRTTAP
    GIWAIGDVIAGPMLAHKAEEDGVAVAEWIAGKAGHVNWDLVPAIVYTSPEVAAVGLGEDGAKAKGLAVKVGKFNLAANGR
    AIAANATDGYVKIIADAKTDRILGCQILGNNAGELISEVVTHMEYGGSAEDLGRTIHAHPTMSEAVKEAGLAVSKSAIHA
    L

    >gi|182416166|ref|YP_001821232.1| heavy metal transport/detoxification protein [Opitutus terrae PB90-1]
    MQPVKQSWILTGGFLSAVAASLCCIGPLVAAVAGAGSFVAAGWFERWRPAFLGVTAALLALAWVLTLRARRIACADGTCA
    TPRASRWTLGVLIFSTVIVGAVAMFPQLAQTTFGRSSVATSAPADGRVLRVRIPSMD
    CAACAVGIAGTLQRVPGIRTAVV
    RYATKEAEVVYDPAVISATTVIAKIDATGFKAEPAN

    >gi|182416188|ref|YP_001821254.1| heavy metal transport/detoxification protein [Opitutus terrae PB90-1]
    MQPVKQSWILTGGFLSAVAASLCCIGPLVAAVAGAGSFVAAGWFERWRPAFLGVTAALLALAWVLTLRARRIACADGTCA
    TPRASRWTLGVLIFSTVIVGAVAMFPQLAQTTFGRSSVATSAPADGRVLRVRIPSMD
    CAACAVGIAGTLQRVPGIRTAVV
    RYATKEAEVVYDPAVISATTVIAKIDATGFKAEPAN

    >gi|182416258|ref|YP_001821324.1| ArsR family transcriptional regulator [Opitutus terrae PB90-1]
    MMRELLSERVIEKPKSVIFGQFALIAKAFAHPLRLQLLEQLAQGERTVETLADRTGASIANASQHLRQMRAAGLLGSRRE
    AKFVYYRLASDVVIEILSGLRRIGEGQLAEVDRVVNGYFNRRDSLEPVTRAELVNRAKSDLVTVLDVRPADEFALGHVPG
    ALNIPFRDLEARLAELDPKQEIVAY
    CRGPYCVLSFEAVAALRARGFNIRRLEDGYPEWRAAGLPVETTSEVAR

    >gi|182416260|ref|YP_001821326.1| DsrE family protein [Opitutus terrae PB90-1]
    MKLGIILSQTEPETVFNALRLANYALKQGDSVKIFLMGKGVALDQIDDARFAVREQAQAVLAAGGQFLACGTCLKLRASE
    GSEICPLSTLKDLYEVVRDSDRVLSF

    >gi|182416357|ref|YP_001821423.1| iron-sulfur cluster assembly accessory protein [Opitutus terrae PB90-1]
    MSELASAPVPALPPAAASASGLPEGVRLGNENLVRLTPAAGTKVAALLARENQGDFLRIAITGGGCNGLSYKMKFVPEPR
    RGDLLVRTAGAEVLVDSKSALYLKGTQLDYSSAMVSGGFKFSNPNAKASCSCGESFSV

    >gi|182414947|ref|YP_001820013.1| alkylhydroperoxidase [Opitutus terrae PB90-1]
    MITTSLETRNTEPRLNYAKAAPGTLQSMLLLQQAVDQSGLEASLLRLIEMRVSQINGCAFCLDMHFREAKAAGESDERLY
    LLDAWHEVDLYTPRERAALRWAEVLTRLSAAAPDDDDFAAARDQFSEAELSHLTLAIVVINGWNRFNVGFRTPPGFAG

    >gi|182413327|ref|YP_001818393.1| hypothetical protein Oter_1509 [Opitutus terrae PB90-1]
    MRFLVALSLAVMLSGAPLRAADVSAEAVEQQLVELAASKEVTVVHLWAPWCPNCAAEMRPDGWAKFVADHPKVKVVFVNI
    WHANQDPAPKLAAGGLGGQPNFVALTHPNPARKKGESLDRLLGFPVTWVPTTWVMRDGKLRYAINYGEVRFDMLQQMVED
    AARKW