Arthrobacter chlorophenolicus A6 uid58969

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|219882592|ref|YP_002477756.1| thioredoxin reductase [Arthrobacter chlorophenolicus A6]
    MSTSLPTETIRDVIIVGSGPAGYTAGIYTGRANLKPLIVAGMMEPGGELMKTTEVENYPGFPEGIDGPDLMANMESQAER
    FGAEILFEEASELELEGPVKKVTTTDGEVHYARTVILSTGSAHRKLGLPNEDALSGHGVSY
    CATCDGSFFKDLEVAVVGG
    GDSAAEEALFLTKFAKAVHLIVRGDQLRASKIMADRVLANPKISVEFETEVVGILGQDKLIGLILRSKDREYDYTVPADG
    LFVAIGNDPRTALVASQLDLTAQGTVAVDGRTSKTNLPGVFAAGDVIDPTYRQAITAAASGCVAAQDVEHFLANSVPALL
    EAATA

    >gi|219883010|ref|YP_002478174.1| hypothetical protein Achl_4406 [Arthrobacter chlorophenolicus A6]
    MSPVITSIAPKSVVVFGKEKGCVQCNAMDRAIAKTDIKVTKVDGTTDENREYCMSLGHTQAPTVVVYQDGVVIDSWSGFN
    PGKIDELKNDPLVERTAPVRELIAA

    >gi|219883277|ref|YP_002478438.1| mercuric reductase [Arthrobacter chlorophenolicus A6]
    MTEAAAAFDYDLAVIGSGGGAFAAAIRATNLGKRVLMVERSTVGGTCVNTGCVPSKALLAAAEARHVALDASGRFPGIST
    TSEPVDMAALIEGKRSLVETMRADKYVDLAAEYGWELRQGNAAFAGSPQEPVLEVTGADGARSEVRAEHYLVATGSTPWA
    PPIEGLQDVEYLTSTTAMELDEVPESLLVFGGGYVALEQAQLFARLGSKVTMLVRSRLASAEEPEASRALMSVFADEGIR
    VVRRATVSAVHTDPATGEVVATATVSGGQEQFRATRLLVAMGRRPVTEGLNLDIVGVKTGDRGEVLVQDTLASTNPRIWA
    AGDVTGHREFVYVAASHGTLMVENAFNQVGREVDYRHLPRVTFTSPALAAVGMTDKEANEAGIRCECRVLPLEYVPRALV
    NRDTRGFIKIVADNSTGRIVGITAVGKEAGDLAAAGVYILEAGMTVDQVANLWSPYLTMAEGIKIAAQSFKTDVSKLSCC
    AS

    >gi|219883280|ref|YP_002478441.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Arthrobacter chlorophenolicus A6]
    MDDHFDVAVLGMGPGGEVAAGRLLKAGKKIAVIERELIGGECAYWACIPSKTVLRPPEARTEVQRAAGVSGAELDWSETS
    GYRDYMIRHLDDKDQIDGYARQGAEVIKGEARITGPGRILAGDRELSADHIIIATGSDPVLPTLEGLDQITAWTNRETYT
    ATTLPERAVIIGGSAVGVETATFLARFGVKVTLIHRGDRLLGREESRAGELAYQYLPEAGVEIRLGVTARRGRREGDQSV
    LDLDDGTEVAGDVVVFATGRTPRTQGLGFEHAGVVLGDRGQVQVDEHCRAGENVWAIGDVTGIMPFTHVAKYQGRIAADA
    ILGTPRKAFYEGIPRVVFADPEIAAAGLTLDQAGRRGLKTAAAEIDLAAAITRPWTYERDPRGHLGLLADTDRKVLIGAW
    AVAPMAGEWIHQASLAIRAQIPIETLRDQVAQYPTYHEAYQAALDKLEI

    >gi|219883287|ref|YP_002478448.1| Redoxin domain protein [Arthrobacter chlorophenolicus A6]
    MSTLTPPAPSSPKTAAVRRRTVRAVFTASGITAALLLAGCGTPAGPGAAPPASQGPAAAPAPGSPATAVTVKALDGSSLK
    LPTGKPTVIYFFTAS
    CGPCAAGVKNVASGLAKSSGATAVAVDLDPSEPTEVLNQFMGSVGNPPLTLVRDDGTLLKQFNVD
    ALGTTVVLDPSGKEVYRGVDPSADQTAKALTAAAS

    >gi|219883292|ref|YP_002478453.1| Redoxin domain protein [Arthrobacter chlorophenolicus A6]
    MTTTKNRRRLFTIAAIIAAVALVLILASTALKRGGEADTSADAASGNSVERIEVASVTGEAVTVPSTRPTVLYFMASWCY
    TCVPQAEAMKNLEQEYAGKADFIAVDVTPENTKAQVDEFRKLAGDPGHPYVVDKTGQLTKKYGITSLDSTVVVASDGKVL
    GRADARPMKADALRTFLDKTLP

    >gi|219883405|ref|YP_002478566.1| glutaredoxin [Arthrobacter chlorophenolicus A6]
    MTATPAAYTVYTKPDCPNCEKTKDYFDSKGITYTAVDITEVPAALEYITAELGYSQAPVVQNNFDDQDHWSGLRRDKLVQ
    AAMSHKAA

    >gi|220910984|ref|YP_002486293.1| Rhodanese domain protein [Arthrobacter chlorophenolicus A6]
    MTSPSAAAVTALAPETLRSWITEHQDLVVIDVRSAAEFESMHIRGSYNVPLPLLAEHTDELAARLGSRVVLVCQSGIRAE
    QARQRLAKSGIETAYVLTGGAPGYAGAGGDVVKGKDRWDLERQVRLVAGSLVVLGLAGGKFVSPKIRTLAGVIGTGLTFS
    AATNTCAMGKAISAMPWNKAAKEPTRESAILGLPVSNKSTEAAA

    >gi|220910986|ref|YP_002486295.1| Rhodanese domain protein [Arthrobacter chlorophenolicus A6]
    MGLISSLKKAFGKPYKTISVAGAKRLLSSGAALIDVRSAQEWRSGRALQAKHIPLDRLQASTTGINKTRPVITVCASGIR
    SASAARALAEQGFEAYSVRGGMAAWRQAGEPVR

    >gi|220910987|ref|YP_002486296.1| Rhodanese domain protein [Arthrobacter chlorophenolicus A6]
    MAEITITETDQRRATDNVLDVREDFEVAEGMIPGALHIPMGQLQARLGELDPAVPVIAVCRSGNRSAAVADALSGAGYKA
    DTMAGGMTAWARAGLPTT

    >gi|220910988|ref|YP_002486297.1| thioredoxin [Arthrobacter chlorophenolicus A6]
    MATIDITEHTFAQTLEGSDIVFVDFWAAWCGPCRMFAPTYGAAAERHPDITFAKVDTEAERGLAAAANITSIPTLMAFKD
    KTLVFSQPGALNATGLEEVIQAVKALDMDKASDDAGIQHA

    >gi|220910989|ref|YP_002486298.1| beta-lactamase domain protein [Arthrobacter chlorophenolicus A6]
    MLIERIYDEDLAQASYLIGCQAKGEAIVVDGRRDIAVYQDLAAKNGMKIVAVTETHIHADYLSGTRELAAATGAKVYVSG
    EGGPDWQYEFDGERLYDGDAITLGNITIKALHTPGHTPEHLSFLVTDGAFSDQPGYLLSGDFVFSGDLGRPDLLDEAAGG
    IDTRFEGAKQLFASLRDKFLTLPDYVQVHPAHGAGSACGKALGAIPSSTVGYERLYAWWGPYLAANDEQGFIDELLDGQP
    DAHAYFGRMKRENREGPAVMGERTPLPELSTGIVAAGLDEDTLTFIDTRSNSEVHEGTVVRSLNVPAGKSVASYGAWVVN
    PETDKNPLVLLASGQDQAMDMWDHLVRVGIDNVAGYVTGIEELPTFTPKLIQPEELDGFDAAMVLDVRNKTEHTAGHIPG
    SYQLSGGRVMWHLDELPANGTIVTY
    CQSGVRNSVAASALRRAGYDIVELDGSYAAWSMWRQSRPNAVAAH

    >gi|220911061|ref|YP_002486370.1| Rhodanese domain protein [Arthrobacter chlorophenolicus A6]
    MSDFDSVPVNDVPDGAVILDVREDYEWVAGHAEGALHIPLDQIPARLEELDPDADVYVICRTGGRSFRAAQWLTGQGYTA
    INVSGGMDQWLESGKPLVSDNGLKPMVL

    >gi|220911412|ref|YP_002486721.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Arthrobacter chlorophenolicus A6]
    MTEQNPFYDVLVVGGGAAGLSAALMLGRTRRRVAVVDSGEPRNAPAHGVHGFLSRDGISPAELLATGRDQARHYGADIIN
    GTVVAAGGGVDQGFEVTLDDGRLLRGRRLLITTGLVDELPDIPGLRERWGRDVLH
    CPFCHGWEVRDRAIGVLGTGPWSVH
    QALLFRQWSSNITLFLSDVVEPSEDELEQLAARGVKVVPGAVETLRVHGDALKAVVLAGGPEVAVDAVVVGTRVHARLDA
    FSGLSLAAVPHPLGIGDYLETDAEGATSVPGVWAAGNVTDMRAQVLASAAAASWTAVIINNSLMAEEMEHDLTAYRESLA
    VTGA

    >gi|220911474|ref|YP_002486783.1| Glutathione peroxidase [Arthrobacter chlorophenolicus A6]
    MDNYLRTQRVAPLYPIHLTLNDGTTTEFARFKGNVVLVVNVASNCGFTQQYAGLEALYGKFRDRGFEILGVPCNQFAGQE
    PGSDSEIAEFCERNFGVTFPLTAKADVRGKNQHPLYAELTKFKTGILPGLVKWNFEKFLVNRDGDVVARFAPTVEPDSAE
    VIDAIEKALG

    >gi|220911481|ref|YP_002486790.1| DSBA oxidoreductase [Arthrobacter chlorophenolicus A6]
    MPSMKIEIWSDVACPWCFIGKRRFEAALAEFPHRDAVEVQWRSYQLDPGLPEHYDGTELEYLSTRKGMAPQQVSQMFDHV
    AEQAKGEGLEYRFDKVAVANSFTAHRLIHLAAAHGRQDAAKERLLSDHFEHGKDIGSRDYLTALGGDLGLPDADVEELFT
    TDKYADDVRNDFEEGRALGISGVPFFVIDRKFGLSGAQPAATFTAALNQAWQDANPLVLVNSGDGEACGPDGCSV

    >gi|220911588|ref|YP_002486897.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Arthrobacter chlorophenolicus A6]
    MIPEPAGREYDVVIIGAGAAGENVADRVVKGGLTAVLVEAELVGGECSYWACMPSKALLRPGTALHGAQTTPGAKEAVTR
    TLDAKAVLSRRNYFTSNWTDDSQVDWVKDSGIELVRGHAFLTAPRTVEVAGLDGTEHRLHARHAVVLATGSVPTQPPIDG
    LADVQVWSNREATSASEVPARLAVLGGGVAGTELAQAFARLGSAVTLIARSGLLGSFPEEAAGLVAAGLRADGVDLRLHT
    ATQRIGMNDDGTFSIGLGDGSSVTADKVLVSTGRHPALEGLGLESIGIEPDADGRLLLETDSTGLVQAAQGDGHWLYAVG
    DAAGKNLYTHQGKYEARATGDAIAARAKGELDGGPADWSRFAQTANDHAVPGVVFTDPELATVGRSIQRARKDGYNVSSV
    ELPIQVAGSSLHSENYEGWAQLVIDEDRKVLLGATFAGPDVAELLHAATIAVVGEVPLHRLWHAVPAYPTISEVWLRLLE
    KYGL

    >gi|220911979|ref|YP_002487288.1| OsmC family protein [Arthrobacter chlorophenolicus A6]
    MKTLYTAEALASGEGRDGSARSNDGKLEVGLASPVELGGSGEGTNPEQLFAAGYAACFHSALRLVGRKERADLTDSAVAA
    KVHLGQLDDGAGFGLAAELEIALPALDLATAEALVAKAHQV
    CPYSNATRGNITVELKVLEYAA

    >gi|220912200|ref|YP_002487509.1| thioredoxin [Arthrobacter chlorophenolicus A6]
    MACPACGKTNRIPAQAAGRPRCGNCKAGLPWIVDAGDADFGRVAEESPVPVLVDFWAAWCGPCRMVSPVLDKLARERPGA
    IKLVKVDVDKSPALSRRFDVQAIPTLMVLVDGKVAARQAGAAPADALRSWLDKALSGAGR

    >gi|220912275|ref|YP_002487584.1| methylated-DNA/protein-cysteine methyltransferase [Arthrobacter chlorophenolicus A6]
    MTAQLLQLSTPDGPFTILARDGVVLASGWTAGPGALTGQIHPALLPASFEEVTTLGGISDAVEAFYSGDPAPAMAVPVQQ
    QSGPFRSHAWEVLREVKPGFPVTYSEYAALAGNPKAVRAAASACAFNAAALFVP
    CHRVIRTDGSLGGFRWGLQVKESLLA
    REAA

    >gi|220912371|ref|YP_002487680.1| OsmC family protein [Arthrobacter chlorophenolicus A6]
    MATTRNAHTVWTGSLTEGSGNTTLDSSGLGTFDVTWKARTEAAEGKTSPEELIAAAHSACFSMAFSHELSQAGFTPEEVN
    TKAEVGFQPGTGITGSHLTLNARIPGISEEDFQRIAEAAKKG
    CPVSQALAGIEISLDATLAS

    >gi|220912374|ref|YP_002487683.1| dihydrolipoamide dehydrogenase [Arthrobacter chlorophenolicus A6]
    MADQATAQEFDILVLGGGSGGYAAALRAVQLGLTVGLVEKAKLGGTCLHNGCIPTKALLHSAELADHARDSAKYGVNVTL
    DSIDMTAVNAYKDGIIAGKYKGLQGLIKSKGITVIEGEGKLQGTDTVVVNGTAYKGKNIILATGSYSRTLPGLEIGGKVI
    TSDQALTMDSIPKSAIILGGGVIGVEFASVWKSFGVDVTIVEGLPSLVPNEDATIIKNFERAFKKRGIKFSTGVFFQGVE
    QNADGVKVTLVDGKTFEADLLLVAVGRGPVTANLGYEDAGITIDRGFVITNERLHTGVGNIYAVGDIVPGVQLAHRGYQQ
    GIFVAEEIAGLKPVIVEDINIPKVTYSEPEIATVGYTEKAAKEKFGDDQVQTQEYNLAGNGKSSILGTSGLVKLVRQKDG
    PVVGVHMIGARMGEQVGEAQLIVNWEAYPEDVAQLLHAHPTQNESLGEAHLALAGKPLHG

    >gi|220912410|ref|YP_002487719.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Arthrobacter chlorophenolicus A6]
    MPHYELAIIGSGSGNSLITPHWDGKRVALIDGGVFGGTCLNVGCIPTKMFVYPAGLAAAPAEARRLGVDLSLDKVHWNGI
    RDRIFGRIDAISASGRRYRADELDNVDLYEEHASFTGPRSLRTDSGVEITADQVVVASGSRPVVPDVDGMDLPQVHTSDT
    VMRVDGLPRRVVVVGGGYIAAEFASVFAGLGSDVTQVNRSGRLLRGHDADIAERFAAAAAERWTLRTGYALQSVADNGDG
    SVTAVFTGNGGEQLRVPADLVLMATGRVPNTDRLGADAAGFDLRDDGLLAVDSKLRVLSGGEPLPGVYALGDAANAYQLK
    HVANREARVVAHNLEHPDRLRSIDYTAVPSAVFSNPQIASVGLTEEEARSGTASGSDVVTALQDYGSTAYGWAMEDHEGV
    VKLIAERSTGRLLGAHILGHEASNLIQPLVQAMYQGTPVHVLARGPYWIHPALMEVVENALLALDTEVPEDAPL

    >gi|220912421|ref|YP_002487730.1| methionine-R-sulfoxide reductase [Arthrobacter chlorophenolicus A6]
    MSIFGNNIFGNKATHAVADPAADSHGTGGEDGRTAPAVQKSDAQWREELTPEEYRVLRQAGTERPYTGEYWDTHTAGVYQ
    CRACGTELFTSNEKFDSHCGWPSFWAPLAEGTVRYIHDRTMGMDRVEVRCGACDSHLGHVFDGEGYGTPTDQRY
    CINSVS
    LRLVPKDGAEPADGATAG

    >gi|220912426|ref|YP_002487735.1| Rhodanese domain protein [Arthrobacter chlorophenolicus A6]
    MPYPVEQNEKFAAYAHPERLVSTEWLAAALESGAVANGELVVVESDEDVLLYETGHIAGAVKIDWHTDLNDDVTRDYVDG
    AAFAELAASKGISRDSTVVIYGDKSNWWAAYALWVFTLFGHQDVRLLDGGRDKWVAEGRDLTKDKPAPAPGNYPVVERDD
    APIRAFKDDVLAHLGKPLIDVRSAEEYTGQRTHMPAYPEEGALRGGHIPTAASVPWARAAAEDGTFRSREELDAIYLGEA
    GLVAGDDVVAY
    CRIGERSSHTWFALKFLLGFESVRNYDGSWTEWGNAVRVPIVKGAERGSFPAAVGV

    >gi|220912709|ref|YP_002488018.1| iron-sulfur cluster assembly accessory protein [Arthrobacter chlorophenolicus A6]
    MSTATNENSTATTSESGELPVHEVNLTDVAAGKVRSLLEQEGRTDLRLRVAVQPGGCSGLIYQLYFDERILDGDAVRDYD
    GVEVVVDKMSVPYLSGASIDFEDTISKQGFTIDNPNAGGSCACGDSFH

    >gi|220912804|ref|YP_002488113.1| glutaredoxin-like protein [Arthrobacter chlorophenolicus A6]
    MDFTPETGTITMFSTTWCGYCNRLKKQLDAQGIGYTEINIEEVEGTAELVEQINGGNRTVPTVLFPDGTAATNPSAAEVK
    NRLAA

    >gi|220912819|ref|YP_002488128.1| protein of unknown function UPF0061 [Arthrobacter chlorophenolicus A6]
    MTAAAESTVALGGRFARELNELAVPWEAEEAPDPKLLVLNGPLAAELGLDPEYLSSEEGVRFLLGNHVPDGATPVAQAYA
    GHQFGGYSPLLGDGRALLLGELQDSRGRLRDLHLKGSGRTPFARAGDGRAVVGPMLREYIVSEAMHALGIPTTRSLAVVA
    TGRQVRRDDMLPGAVLARVAGSHLRVGSFQYARVTENTELLRRLADHAISRHYPEAAAAENPYLALYRAVVAAQASLVAQ
    WMLVGFVHGVMNTDNMTISGETIDYGPCAFIDAFNPAAVYSSIDVGGRYAYANQPVMAEWNLARLAEAMLPLIDEDQEAA
    VPVAVEALGGFRRQYSAAWSGGMATKLGLAAGEPEAAAGAEVQDLVDGVTGILKDGSVDYTLFFRNLAKAARGDSRPVRG
    MVMDLAAYDAWAERWQDLAPDAGLMDRTNPAYIPRNHLVEEALAAATGGDLDPLHRLLEAVSAPYSERPGLERYTQGAPE
    DFGTYMTF
    CGT

    >gi|220912867|ref|YP_002488176.1| glutaredoxin-like protein NrdH [Arthrobacter chlorophenolicus A6]
    MTVTVYTKPACVQCNATYRALDKKGITYQSVDISQDAEALDRLKALGYMQAPVVVTDQDHWSGFRPDKIEELALSAVSSV
    A

    >gi|220912904|ref|YP_002488213.1| hypothetical protein Achl_2156 [Arthrobacter chlorophenolicus A6]
    MTETAKSRADFWFDPLCPFAWITSRWIGEVEAVRDIETVWHVMSLAVLNEGRDLDPAYRESMDNAWGMVRVIIAAQQHGD
    ATVKALYDAMGTLIHEGGEKDRSVVITKALAECGLPASLAEAAESDAYDAQLRASHEEGISLVGQDVGTPVVAFNGTAFF
    GPVLTRIPRGEVAGKLWDATTAIASYPHFFELKRSRTENPEFG

    >gi|220912942|ref|YP_002488251.1| peptide methionine sulfoxide reductase [Arthrobacter chlorophenolicus A6]
    MKTFVLGGGCFWCLDAVYQKTKGVTAVVSGYTGGHDPYPDYYSVCSGTTGHAEVVAVTFDEEIIPAEVILDMFFALHDPT
    TLNRQGYDVGTQYRSSMFYETTEEKILFEEAIDRNQALWSHPIVTEVSRLPRFHVAEEFHQDYYAKHPEQGYCQVIINPK
    LAKARKYYSAWLNA

    >gi|220912949|ref|YP_002488258.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Arthrobacter chlorophenolicus A6]
    MTQAPAAAASSLLAAGDPAPDFELSNQFGEPVRLSSFRGQNVVLVFYPFAFSGICTGELCEIRDNLASFEDSNATVLAVS
    VDSKFSLRAYAGQEGYSFDLLADFWPHGGVARTYGVFDEDSGMARRGTFIIDAGGVIRYTVVNPRGQARDFSAYRTALAG
    LEQA

    >gi|220913028|ref|YP_002488337.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Arthrobacter chlorophenolicus A6]
    MAERLVTGDDAPGFTLKDASGKDVSLSPGSGRNTVVYFYPAAATPGCTKEACDFRDSLASLQSAGYDVVGISPDPVAKLA
    KFAAAEELTFPLLSDEDHAVAEAYGAWGEKKNYGKTYQGLIRSTIVVDPDGKVALAQYNVRATGHVAKLRRDLKLDA

    >gi|220913115|ref|YP_002488424.1| Rhodanese domain protein [Arthrobacter chlorophenolicus A6]
    MNPLMDVARLTGLLAEGRRTVLLDVRWALGDPHGRDHYLAGHLPGAVFVDLATELAAHAEPRRGRHPLPAPADFQASARG
    WGINDGDVVVAYDDTGNMAAARAWWMLRNAGFPEAYLLDGGLAAWRAAGLAVETGPVQPVPGNVALGDGAMPVADAGAAA
    TWAESGLLLDARAGERYRGEVEPVDPRAGHIPGAVSAPTSENIDELGIFLPADALRSRFEALGVREEVPVAVY
    CGSGVTA
    AHQVAALAAAGFAAALYPGSFSEWSNHPDLPVATGPEAGSSAREPAGNGAAGKGSVAL

    >gi|220913241|ref|YP_002488550.1| UBA/THIF-type NAD/FAD binding protein [Arthrobacter chlorophenolicus A6]
    MASTFTANVSAVSLDPLVEPAAELTSEEVERYSRHLIIPEIGSEGQRRLKNAKVLVIGAGGLGSPALLYLAAAGVGTLGI
    IDDDAVDLSNLQRQVIHGVSDVGRPKIESARDAIAALNPLVDVRLHRVRLDASNALELFADYDLILDGADNFATRYLVND
    AAAILGKPYVWGSIFRFDGQVSVFWEKHGPTYRDLYPEAPPAGSVPS
    CGEGGVFGMLCAAVGSLMVTEAVKLITGVGRSL
    LGRVALYDALGGSWREIRVSKDPAASPITELTDYEAFCGIAPQAPADTEHTVTAAQLATMLASRKAGLKDFDLVDVREPG
    EFEIVRIDGAVLIPQGRILAGDAWAEMPQDRDIVFL
    CKAGTRSANVLAAAQKAGYRRVSHLDGGILSWVREVEPQKPVY

    >gi|220913515|ref|YP_002488824.1| thioredoxin [Arthrobacter chlorophenolicus A6]
    MATLDITGEQFASTIEGNDIVLVDFWAEWCGPCKQFGPTYSAVSEKHPDVLFTKVDTEAEQQLAAEAGISSIPTLMAFRE
    KVLVFSQPGALNAQQLEQVVDAVKALDMEEVHAHVAKQREEASAAAKPSGPQDGSQIPDL

    >gi|220913765|ref|YP_002489074.1| thioredoxin reductase [Arthrobacter chlorophenolicus A6]
    MSNEQLIIIGSGPAGYTAAIYAARAGLAPLVLAGSVTAGGALMNTTEVENFPGFPGGIQGPELMDGLQQQAEKFGAKVVF
    DDVTSVDLKGSTKRVVTGAGETHEAPAVILATGSAYKELGLPEEKKLSGHGVSW
    CATCDGFFFREQDIIVVGGGDSAMEE
    ATFLTRFGKSVTVVVRKGELRASRIMAQRAKDNPKIRFEWNSAITAIHGDTKVTGVTLADTRSGETRELGATGIFVAIGH
    LPRTELLTGQVDLDDEGYIKVDSPTTCTNLSGVFACGDAVDHRYRQAITAAGTGCAAALDAERYLAALDDASSIATALVE
    EPTHS

    >gi|220913832|ref|YP_002489141.1| Redoxin domain protein [Arthrobacter chlorophenolicus A6]
    MTHNNLTSRRSVLAAGGLALTALTVGLSGCTQEDALAKQARAGDNKNYVAGDGSVTEFAAADRKDAIQVNGTLFNGTTVT
    PADFQDKVTILNFWFAA
    CAPCRVEAPILEELHQEFKDQGVQFFGVNLRDEKATAEAFDKTFKLTYPSFDDKDGGVLLSVS
    GLVPPGAVPTTLVLDKQGRVASRVLGEIQKGTLKALITAAVAE

    >gi|220913838|ref|YP_002489147.1| glutaredoxin 2 [Arthrobacter chlorophenolicus A6]
    MPTPHVVLVTKANCHLCEDARDAVGRVTAALGLTWSEELVDNQPELRERYAEEIPVVLVDGVQRDFWKIDEARLERVLQR
    AMAQ

    >gi|220913894|ref|YP_002489203.1| Rhodanese domain protein [Arthrobacter chlorophenolicus A6]
    MALNRIVLFYGFTPIPDPDAVRLWQRALCEKLGLTGRIIISKDGINATVGGEIGAVKQYVKTTREYKGFHGIDVKWSDGG
    AEDFPRLSVKVRDEIVSFGAPGELTVDAGGVVGGGTHLKPEELHELVEARKQSGDEVVFFDGRNAFEAQIGRFKDAVVPD
    VATTHDFIKELDSGKYDALKDKPVATY
    CTGGIRCEVLSSLMVNRGFKEVYQLDGGIVRYGETFKDQGLWEGSLYVFDKRM
    HLEFSDEAKTIGECVRCKAPTSKFENCSNPSCRTLTLYCADCAASPETLRCPGGCAA

    >gi|220914179|ref|YP_002489488.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Arthrobacter chlorophenolicus A6]
    MTTAPNNTVPTNTVPTNTAPNNTAPYAARLQPGSPAPAFTLPDAGGNPVSLESFQGRNVIVYFYPKAATPGCTTEACDFR
    DNLASLQGRGYDVLGVSPDAPEALAGFTADHSLTFPLLSDRDHAVARAYGAWGEKLVNGEIVEGVLRSTVVVGPDGRAIL
    AQYQVDAQGHVAALREELGL

    >gi|220914181|ref|YP_002489490.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Arthrobacter chlorophenolicus A6]
    MSQTLTTKLQPGTPAPDFTLRDAQGREISLADYRGKNVIVYFYPKAATPGCTTEACDFRDSLGALQGQGYEVVGISPDAQ
    EALAGFSGDFSLTFPLLSDQDHAVALAYGAWGEKLVDGEIVEGIVRSTVVVDTEGKVVLAQYQVKADGHVARLKEALGL

    >gi|220914451|ref|YP_002489760.1| NHL repeat containing protein [Arthrobacter chlorophenolicus A6]
    MSETVRTHARVRASELVGRNWLNTGGKTLDLEALRGKIVLLDFWTFCCINCLHVLDELRPLEEQYSDVLVTVGVHSPKFE
    HEADPVALAAAVERYEIHHPVLDDPELDTWKAYTARAWPTLVVIDPEGYIVAHLSGEGHADGLAVLIPELIAEHEAKGTL
    HRGSGPYVAPEATSGTLRFPGKALFLPAGRGSTAAEEASDGGAAAGAAASGSDGKGSWLVTDTGHHRLVELGTDFETVLA
    TYGSGTKGYADGTAAGEDATAQFNEPQGLVLLPEDVAAKVGYDVVIADSVNHRLRGLSLTDGKALTLAGNGVQRLLETGP
    ARVDEDGAGFSGSLGNDPLDVSLSSPWDVVWSRKLNAVVVAMAGTHQIFSFDPLTGAVAIVAGNGLEGLLDGPAHESWFA
    QSSGLAEDADGNIWVADSETSALRTLVIDDTGSLTVKTAVGKGLFDFGFRDGTAAEARLQHPLGVTVLPDGSVAIADTYN
    GAVRRFDPATGTVSTLARGLAEPSDVIVDATGAAGSEPLLVVVEANKHQLVYVPIPKEAQQVDEGASQTQRPKSPVAPGP
    LELAVRFTAPTGQKLDDRWGDPTQLKISSTPPELLVSGGGTSVGLLRTLELSPDVPEGVLHITARAAACDGPETEDGEIP
    DHAACHLYQQDWGIPVLLQADGDTELVLDLRGMD

    >gi|220914606|ref|YP_002489915.1| heavy metal translocating P-type ATPase [Arthrobacter chlorophenolicus A6]
    MGHQELLQPPGTRVVELDIEGMTCASCVNRVEKKLGKLAGVAASVNLPLESAHVTAPEGITDDQLVATVNAAGYTATVRT
    PPAPSDTGGPEAAGADHHTAHGGTAAQLRPRLILAAILTVPVFLVSMVPAFQFPHWGWVAGALALPVVTWAAWPFHRAAA
    VNARHLASTMDTLVSIGVTAAYLFSAWQLVADPRMTEHPGMEGMDAGGLYFEVAAVVTTFLLLGRYLEANAKQKAGDALK
    ALLNLGAKDATILREGAEYRVSADRLHVGDVLVVRPGEKIAADGVVLDGTSAVDASLVTGESVPVEVGPGSKVTGATINT
    SGRLLVRATRVGAETTLAQMARLVSQAQTGKAPIARLADRISAVFVPVVLAIAAATFLLWLFIAGPGGTDGGLRAAVTAA
    VAVLVIACPCALGLATPVGLLTGTGRGAQLGILIKGPQVLEDTRTVDTILLDKTGTVTTGVLAVESTVAFGGFNRQQVLR
    LAGAVEAASEHPVARAIAAAAKEIIPARPGSAADDDGRLPAVDGFRSAPGGGVTGTVEGRLVLAGRTGWLRDNGIEPPPE
    QLESLAEAEAAGATAVWVAVDGVPAGIISLRDTVKEGSAAAVARLKELGLRPILLTGDNAAVAAQVAAAVGIPPADVYAG
    VLPEGKVEAVRRLQAGGATVAMAGDGVNDAAALAQADLGIAMGSGTDVAIEAADLTVMGNDLTQVAQAIELSRRTLATIK
    TNLFWAFFYNAVGIPVAALGLLNPMIAGAAMAASSVLVVANSLRLRSFGK

    >gi|220914660|ref|YP_002489969.1| thioredoxin reductase [Arthrobacter chlorophenolicus A6]
    MTIAETTASEVRDVIIVGSGPAGYTAAVYTARANLKPLLFAGSVTAGGELMNTTDVENYPGFPEGIMGPDLMENFEKQAT
    RFGTEIQFEDVTALDLESPVKTVTIATGETFKARSIILSTGSAYRELGLPNEKRLSGHGVSW
    CATCDGFFFKDQDIAVVG
    GGDSAMEEALFLTKFAKSVTVVHRRDSLKASKIMADRALAHDKIKFIWNSTVEDVIGESKVTSLKLKNLVDGNVTDLAVT
    GVFVAIGNDPRTDLVKDVLDLTPEGTIAVQGRSSKTSIPGVFAAGDVVDPTYRQAITASGSGCVAAIDVEHYLADLPA

    >gi|220914661|ref|YP_002489970.1| thioredoxin [Arthrobacter chlorophenolicus A6]
    MSNAKDVTDASFGTDVLSSEKPVIVDFWAEWCGPCRKLGPILDEISVEYGEKVDVVKVNVDDNPAIAAEYGITSIPAVYL
    FQGGEVKNTVIGAKPKQFFEKEFADVLS

    >gi|220912651|ref|YP_002487960.1| putative glutathione S-transferase [Arthrobacter chlorophenolicus A6]
    MSHDTESTQTAGGTGEHSTRGAYVTGGQEFTRDTNYIEDRVTRDGRPGDHGEPGWPAEAGRYRLVAARACPWANRTVIVR
    RLLGLEEAISLGQPGPTHDSRSWTFDLDPGGKDPVLGIERLQEAYFKRFPDYPRGITVPALVDVPTGAVVTNNFPQITLD
    FSTEWTAFHRPGAPDLYPERFRDEIDEVNKRVFTEVNNGVYRCGFAGSQDAYQAAYDRLWTAMDWLEDRLAGQRYLVGDT
    ITEADVRLFTTLARFDAVYHGHFKCNRQKLSEMPALWAYARDLFQTPGFGDTTDFVQIKQHYYIVHEDINPTGIVPAGPD
    LSGWLERHGREALGGRPFGDGMPPGPVRKGEEVALGHGAVR