Onion yellows phytoplasma OY M uid58015

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|39938571|ref|NP_950337.1| hypothetical protein PAM_085 [Onion yellows phytoplasma OY-M]
    MHAISIEKRHNYFMTQTSNSQYLVILYYQYAPIKDPQTFRDQHFKYCESIGLLGRIIVAQEGINGTLSGPEEQIHKYMDQ
    LKQDPRFCNTVFKMETVEAHVFPRLSIKVKPELVNLSLQENVDLTKDKGAYLAPQEFLQALQEKDTLILDARNDYEYDLG
    HFRNAVNPNIRHFRDLPNWVKQNTHLLKDKKIVTY
    CTGGVRCEKFSTFLKKEGFDDVYQLEGGIISYGKHPETQGALWDG
    QMYVFDQRIAVPVNQKEHVIVGKDYFDGTPCERYINCSNPQCNKQILCHEYNEHKYLGACSDKCSNHPQNRYLKKHNNPN
    S

    >gi|39938782|ref|NP_950548.1| hypothetical protein PAM_296 [Onion yellows phytoplasma OY-M]
    MIIFKTTAYFNPHLDDLCFFEEKEGITKKLVSALEPSNKQSGPVDLFCLSWAICFYKTSKKILAEQDYTNKDLKVKVTLE
    MQKDDKGFYFKPTAILGIQDMTLEQTEIIADATHKR
    CPISRLISADENVSVKVLNYNELITE

    >gi|39938927|ref|NP_950693.1| uncharacterized NAD-dependent dehydrogenase [Onion yellows phytoplasma OY-M]
    MKVIVVGCTHAGTAAVKTIKKNNPQADVVVYERNDNISFLSCGIALYVGGVIKDSLGLFYSNPDELVSMDVCTKLKHEVL
    KLNFDKKEVLVQSLETGKQFKDNYDKLVIATGSWPVIPPIKGIDCKNVLMSKNFDHAKDIINYSKNVNKITIVGAGYIGI
    ELAEAFAVQKKEVVLVDAEDRIMSKYLDKEFTDVAQKTLTDHGVTLALGQKIAGFETKDGLVTHVKTDKNTFETEMVIMC
    ISFKPNTQLFAHHLETSFNGALVVNEYMQTSDPDVYACGDCVNVYYNPTQEVKYMPLATNAIRMGTLVGLNIEKPCVKYL
    GTQGTSGIKIIDLSISSTGLTENVAKALGKNYGTVTIKDANRPEFMPDYDAVMLKLVFDKETRKILGGQIVSRVDLTEKM
    NTLSVCMQNQMTVEQLAFVDFFFQPHFNKPWGLLNLAGLKALEVKSQ

    >gi|39939089|ref|NP_950855.1| fatty acid/phospholipid biosynthesis enzyme [Onion yellows phytoplasma OY-M]
    MKNYDVLVIGGGPGGYVAAIKAAQMGAKVALVEKHKLGGICLNYGCIPTKAYLKSAKMYKDIKRCADFGIKVQNGVSFDW
    SSILSRKNKIVAQLTTGISFLLKKNKIDFYHGFASVLSPCEVQVDTNLLHTQKLIIATGSTAFVTPIPGAQEAYQKGILK
    TSKELLQLESYPSKVTIVGGGVIGVEFATIFNSFGSEVTILERQDNILNGMDRDVVVAYTKKLQADGIQILTQVEVTKIN
    DNQTTYTQKGNAKTITSDVILMAVGTKANLAGLEKLNLALNRNSVQTDNFCQTSIPGVYAIGDVNGKHMLAHVASHEGIV
    AVTHALEQKAQPINYDRVPACIYGFPEIASIGMTEQQAKEKQMDYKVSKISLGAVGKSLADGEKEGFAKLIVCKKHLEIL
    GMHIYAYNATELISEMAVGMELEGTAYELSQAIHPHPTLSELTFEALLGAVDKPIHA

    >gi|39939118|ref|NP_950884.1| hypothetical protein PAM_632 [Onion yellows phytoplasma OY-M]
    MVIVYTSFSCFSCKKVKKWLKAHGVRYEERNFLNYKMQSQDLDLILKNCDYGFDDIISRRSKIFKEKQIDLETINNDNIK
    KIIIENPEILKRPIIIKDQKI