Olsenella uli DSM 7084 uid51367

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|302335217|ref|YP_003800424.1| methylated-DNA/protein-cysteinemethyltransferase [Olsenella uli DSM 7084]
    MDYVHHYDSPLGGITIASDGVALVGLWFDGQKHFPDPLVLGALAEGSAESDPPVSAQTDAWLDAYFAGSDPGPTPPLAPR
    GTAFRREVWEILLQIPYGRTTTYGDIAAQLARRCGLGHFSAQAVGGAVGHNPISVIIP
    CHRVLGSDGSLTGYAGGLERKA
    ALLALERTGGMRSGAPLPELPSHGGAGRRELRASRRPR

    >gi|302335427|ref|YP_003800634.1| Rhodanese domain protein [Olsenella uli DSM 7084]
    MRTIASMDEGVAEARRTPGARLVDVREEGEFLAGHVPDAANVPLSQLGRIADVAQDRATPLFLYCASGARSARAARELVR
    AGYADVRDIGGINDYTGPRT

    >gi|302335445|ref|YP_003800652.1| peroxiredoxin [Olsenella uli DSM 7084]
    MSLIGKEIGDFSVQAYQDNGFRTVTKADVLGTWSLFFFYPADFTFVCPTELEELAENYEAFKAEGCEVYSVSCDTEFTHM
    AWHGSSARIGQVSYPMLADPAHVLARDFEVLVEDAGQAERGAFVVDPEGRIQVYEVTASGIGRNAQELLRLVQAAKFVAE
    HGDQVCPAKWRPGSKTLTPGADLVGKL

    >gi|302335482|ref|YP_003800689.1| arsenate reductase-like protein [Olsenella uli DSM 7084]
    MAEDALLVLHYPRCSTCKRALKWLDGHGVAYTPRDIVAQNPTAEELRLWHSGSALPVRRLFNTSGMLYRDMGLKDRLARM
    SDEECYELLATNGMLVKRPLVVGTGLLLAGFREWEWADQLLG

    >gi|302335713|ref|YP_003800920.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Olsenella uli DSM 7084]
    MARDSIRGCDIAIIGGGSAGLAAAIAAHDAGVDDVVVIERDAVLGGILNQCIHNGFGLHTFKEELTGPEYASRFIAQADE
    RHIDRLLRTTVLDVTASHVVRAVSADRGVFSLEAKAIVLAMGCRERPRGALDIAGFRPAGVYTAG
    CAQKLVNVDGYLPGR
    RVVILGSGDVGLIMARRLTLEGAQVACVAELMPYSGGLKRNIVQCLDDFDIPLHLSHTVTRIEGPKRVEAVTIARVDERL
    RPIPGTDRRYECDTLLLSVGLLPENELSRQAGVKLSPVTQGPEVSESLETSIEGIFACGNVLHVHDLVDYVSEEAALAGR
    RAARYVKEMSGGVAGTQREGGAMREGGDTPSRLRVRTGGGVRYTVPSFVSPDLMDERLTLRFRVGAVYEERYVSVYLGER
    RIIHRRRPILVPAEMQEVVLVRDQLLGALGDMGGSGAKAHAGDVGACRDLRVTLEEA

    >gi|302335715|ref|YP_003800922.1| methylated-DNA/protein-cysteinemethyltransferase [Olsenella uli DSM 7084]
    MAERFFARVYDVVRQIPEGRVATYGQVASMVGEPRKARFVGFAMHSSPGAKGGVPCHRVVFKDGSLCAGYVFGGPDAQRA
    LLEEEGVTFLADGRVDMGLCQWEA

    >gi|302335729|ref|YP_003800936.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Olsenella uli DSM 7084]
    MDTEVKDLVIVGGGPAGLSAAIYAQRALLDTVVLEQEAVGGQVILTSEVDNYPGVPHTDGFTLTDAMKAQAEDLGATIEM
    SNVEKISHDDDAGLFSVSTPVGSYVSRTVIVAGGATPRHVGFDGEEHFGGHGVSY
    CATCDGMFYRGKRVFVIGGGNSAAE
    EALFLTKFADHVTMVVRKDHLRAQASVARQVEESDKVDVMFNTQVIRLEGDRLPRSITLRDTRSGDEETREFDEGSFGVF
    VFVGRVPASGLLDGLAALDERGYVVTNDRMETSTPGLFAAGDVRQKPLRQIITAAADGAVAATSASAYLGQPIEG

    >gi|302335790|ref|YP_003800997.1| NADH ubiquinone oxidoreductase, F subunit, iron sulfur binding protein [Olsenella uli DSM 7084]
    MTIINFMPVYRQAPVSLRLLEERLDEAVERAASEDVTLILPKGRTDLASRFGEGKVVLADETIGFLYGNDTAAAKLLSGE
    KPVPSSVTGAAEDEVVSGEAWLCGQDGTKRVWLEGANDPVEVDATTTAAGLLSVTAVPTEGLRAVYLGYPQSRFLVPGEL
    DEPMELSCDYMCVYTDANCMANALHEIATTFHRECCGRCVFGYEGGYQLETILGDAVGKRGRMGDLDLMRDLCPTMSTQS
    L
    CELGRIMARTVQEGIDLFGDELDRHVSKRSCPAGECKAFMTYHILVSRCTGCGDCLAACEEDAITGKDKFVHVIDQKAC
    IQCGRCLEACGEGAVVMAGARKPKTPPRPIPCKRS

    >gi|302336110|ref|YP_003801317.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Olsenella uli DSM 7084]
    MFDHTDHIRADRPTPRPAFGPGAAPSPDALAAASSARAACDQKVVAVVGCTHAGTFATQSILAQHPSWQVHVFERNDTLS
    FLS
    CGIALWVGNNVSDPRRMFYSSPEALASLGATMHMRCDVTSVDLAAKTLAWRGIDSGETGTLAFDKIVAATGSKPVLP
    PIPGLAEGLGIGRVLRCKNWDDGRAIKEKVAVAASVAVVGAGYIGAELAEQISLMGARVTLIDGLGRVLAKNFDADVTKL
    VEEAYAAHGVELALGQVVERVSADADGVTVVSGGRERRVDYLIMAAGFLPRTDLFSGMLDMLPNGAIKVDEYMRATPLAA
    DGTPEAESSPDVLAAGDSATVLYNPTGKPDYIPLATNAVRQGLLVGANIAAPTQAYRGTQSTSAVQLYGLSLAATGLTAG
    HAEALGMRLRSTTLVQDYRPDFMLTTEPVTCILTWDPATREVKGAQFACPHDVSQAANAVSIAIHNHNTIDDLAAFDFLF
    QPNFCQPVNYLGAVAMQAVAEG

    >gi|302336143|ref|YP_003801350.1| glutaredoxin [Olsenella uli DSM 7084]
    MAEKPELYVKTSCPYCAKVESFMESNGIELQTHNIDTDAAARSYLIENGGKRQVPCLFVDGKALYESNDIIDYLGREFGA
    DKAAQEEDATSAAGGACSLDGSGCSF

    >gi|302336496|ref|YP_003801703.1| thioredoxin [Olsenella uli DSM 7084]
    MANAITTAEFDSVLANADKPVLVDFWASWCGPCRALGPVVEQVADEMSDQLALYKCNVDDEGDLAQRFQIVSIPTMILFK
    GGKPVHTMVGNMPKAELVKELQANL

    >gi|302336531|ref|YP_003801738.1| Redoxin domain protein [Olsenella uli DSM 7084]
    MKEVTKKALVSAAGILMTISLVGCGANSKSQSTETAPDAAAAVESGSTDVPPEAASKLHLKGGDAFPNFEATNISNDETV
    TNEVFKKNKVTVLSFWFNG
    CTSCVKEMPLLQELSDKYKDQGVSVLGVNAEAGFTDDAKKEGQDILSKQGITYDNIAFNSK
    SDANQVIEGLTAFPTTMVIDQDGKLVGDPITGGLNKLEGSELLKRVDEALAKAKDN