Oenococcus oeni PSU 1 uid59417

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|116490254|ref|YP_809798.1| ribonucleoside-diphosphate reductase class Ib glutaredoxin subunit [Oenococcus oeni PSU-1]
    MADITVYTKNNCVQCKMTKKFLTSMNIDFKEINIDEHPELIAQLKAEGHRQTPVVKISGFDSFSGFRPDALKKVVAAKAA
    A

    >gi|116490427|ref|YP_809971.1| dihydrolipoamide dehydrogenase [Oenococcus oeni PSU-1]
    MATGGVVGAQATDIDTVVIGSGPGGYVAAIRAAELGQKVTIIESTFIGGVCLNVGCIPSKALINVGHHYHDAVSEQPFGL
    KSSGTELDWKTTQEWKQKKVVNQLTGGVEMLLKKHRVDIIHGVASFVDNKQINVVKGDDHELFQFNNCILATGSRPIEIP
    GFAFGKRIVDSTAALSLPEIPKHLIVIGGGVIGFELGSVYQNLGSKVTVIEGLDHVLSGFDKEMIQPVLDDFKAQGGEIF
    TSAKAKSASQTEKDVTVTFEADGKEQTVDGDYLLVSVGRRPNTDNIGLNNTNVKLTDRGLVEIDDTMKTNVSHIYAIGDI
    TVGPALAHKASFQGKIAAAAISGDQNAHDLHYSLPAVAYTNYELATTGETPESVKEKKLDAKAYKFPFAANGRALSINEG
    KGFIRLISDNQTKALIGSQIVGPGASDLISELSLAIENGLTTEDISLTIHPHPTLGEAIMDASELADGLPIHI

    >gi|116490443|ref|YP_809987.1| Thiol-disulfide isomerase and thioredoxin [Oenococcus oeni PSU-1]
    MIKEIHDQDFAKETDTGIAVIDFRADWCPPCRMMDPILKSLSEDPAYKDQVNFVSLNIDHDQATASQFQVQGIPTFLIKK
    DGQVVSHMVGARPKPDFEAELKKALA

    >gi|116490579|ref|YP_810123.1| peptide methionine sulfoxide reductase [Oenococcus oeni PSU-1]
    MTKNNCEEILNDIYNLILNPATSAWERSLLSSAKNAIGEDMNFERQLSKLEFELRPLAVRNNLTADVTDFYMKITGNSPD
    HLQFDFSKHYAKDLSYQDRAIFAGG
    CFWCMVEPFENERGIVSVLSGYTGGHVDHPTYEQVVSGYTGHVEAVEIIFDTRII
    QYTELLDLYWQITDPTDEFGQINDHGDNYRPVIFVRNEEQRKIAESSKLKLAESGMYNRPIVTAIEPATKFWPAENFHQQ
    FYKKNPKKYKIIEKSRQRYLAFQHLQGRIRLGLKGLTKKH

    >gi|116490632|ref|YP_810176.1| thioredoxin reductase [Oenococcus oeni PSU-1]
    MTQKYDVVIIGAGPAGMTTATYASRANLSVMMINKGIYGGQMNDTAEVENYPAFDSILGPDLAEKMYASSTRFGAEYTFG
    EVQNVIDHGKTKTIVTDDEQYEAKVVIVASGATHRHIGVPGEDKYSGRGVSY
    CAVCDGAFFKNEQIVVIGGGDSAVEEAS
    YLANLAKDVTIVHRRDQLRASRIAQKRAFDTDNIDFSWNKRTEEIIGDDEKVTGVKVLDKISNQESVIKTNGVFIYVGID
    PNTQGLENLGILDEKGWVLTDDNMQTKVPGIYAVGDVRKDSIRQIAAAVGDGAVAGKILFDYIQSLSDTEIEA

    >gi|116490846|ref|YP_810390.1| methylated DNA-protein cysteine methyltransferase [Oenococcus oeni PSU-1]
    MKVNYRQQINYSSINFLDWKFSFFSSDKGLIFTTFQDDPIADFSKWSGISKLVNRENPKISSAFLDYFSGRSSSPKISID
    WNFWQFSNFQILILKKLLEIDKPVSYSEFARRIGNQKAVRAVATAVGKNPFEVVVP
    CHRIITKSGKIGKYRDGSNIKAAL
    LQLEKQL

    >gi|116490919|ref|YP_810463.1| ribonucleoside-diphosphate reductase class Ib glutaredoxin subunit [Oenococcus oeni PSU-1]
    MIKIYTRDDCPQCYMTKKWLDNHQLEYTEINISRDKKYIDYLKAKGAQQTPYVVTDRENWSGFRPNKLIMLIR

    >gi|116490926|ref|YP_810470.1| glutathione peroxidase [Oenococcus oeni PSU-1]
    MSIYDYKATLENGESYKLDKYKGKIMVIVNTATKCGFAPQFEELEKIYKQFKDSGLVVLGFPSNQFKQELDSSQAAAEAC
    RTTYGVTFLMHEINDVNGKDELPLFSYLKDNAPGAIGKSIKWNFTKFLVKQDGEVAKRYAPKTDPEKMIPDIEELLQLQK


    >gi|116491206|ref|YP_810750.1| glutathione reductase [Oenococcus oeni PSU-1]
    MKNQQYDYDVLYIGSGHGTFDGAIPLAAKGFKVGIVEYDLVGGTCPNRGCNAKITLDAPVALQRQFENLNGVIEGEAKIN
    WSANLTHKQEVIGKLPDMIAGLAKSVHIDILSGHGVLDDPHTVLVDGTPKTAEKIVIATGLRPHRLDISGSELAHDSSDF
    MNLSAMPKRLTVIGSGYIAMEFATMANAAGSEVTVITHGNRALRKFNQDFVEKIIDDLQKRGVKFVRNTEVTSFEKTGTA
    LTVNAEDNFQLETDWILDATGRIPNVEKIGLDKLGVEYNKNGVVVNDHLQTNVPNIYASGDVIDKIQPKLTPTAVFESTY
    LMHQFAGDSSSAIDYPAIPSVVFTSPRIAQVGVTPEEAKKNPDKYTIETHHTPDDWYRQVDKEQLGDNALIFDKEHHLVG
    ASEFSDKADDAINTLLPAIEFKLGPEQLGRLIYLFPSISSSAAGQL

    >gi|116491516|ref|YP_811060.1| peptide methionine sulfoxide reductase [Oenococcus oeni PSU-1]
    MANEIQTAIFAGGCFWCMVEPFDSLPGIIKVRSGYTGGHVDHPTYEQVSSHQTGHTEAVKIWFDPKKISYAELVDLYWQV
    TDPTDAGGQFQDRGDNYRPVIFVNSDSQHQTALSSKQKLLDSGVFGEDPIVTKIEKAQTFWEAEDYHQDFYKYNQARMKV
    QDAPREDFIKEHWNKQKADD

    >gi|116491530|ref|YP_811074.1| peptide methionine sulfoxide reductase domain-containing protein [Oenococcus oeni PSU-1]
    MADKDLSHLSKEQYEVTQKGATERAFTGKYDDFYEEGIYVDVVDGTPLFSSKDKYDAGCGWPSFTKPIENPSIVKKIDQS
    LGMTRTEVRSKDSGSHLGHVFDDGPDDKGGLRY
    CINSAALKFIPVKELKKAGYGEYLSLFK

    >gi|116491597|ref|YP_811141.1| Thiol-disulfide isomerase and thioredoxin [Oenococcus oeni PSU-1]
    MNFYEPETNTDDQLKKNIEAKGRNLMFLSADWCGDCKAIKPFVQNIKDQVSKTANWFDADRDANLEIAKSQGLRGIPSFV
    LFQDGKQLSHIGDGERLTPKQVLDWYQTTL

    >gi|116491669|ref|YP_811213.1| Thiol-disulfide isomerase and thioredoxin [Oenococcus oeni PSU-1]
    MAISVLNSDSFEEATKSGVTVTDFWATWCTPCKIQAPILEKLSNEMSSVKFGKIDVDQNQETANGLGIKAIPTLIVKKDG
    EVVDRIVGVHNQKQLTDIIDKYTK

    >gi|116491805|ref|YP_811349.1| redox protein, regulator of disulfide bond formation [Oenococcus oeni PSU-1]
    MQKIYAATMINTGGRSGESHSPNHSFELNIEQPGSKVSGTNPEELFAAGYSACFNSALDYIKKSDGINGSSTVKVRVSLY
    NQSQNEIPDVVLGVEIKGVIEGISLDKAQALLNKAHET
    CPYSRAVKGNIEVSVEAVDQI