Oceanobacillus iheyensis HTE831 uid57867

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|23097718|ref|NP_691184.1| glutathione peroxidase [Oceanobacillus iheyensis HTE831]
    MSIYEYQVEKSNGEEISLSQYQDNVLLIVNTATKCGFANQFEGLEELHQKYQDEGLRVLGFPSNQFNEQEPVDDENMEEA
    CKVNFGVTFPLFKKIDVKGPNAAPLFKYLTEEQKGLLGSNVKWNFTKFLVDRNGNVVKRFAPKDKPAKIEDDIKALL

    >gi|23097730|ref|NP_691196.1| thioredoxin [Oceanobacillus iheyensis HTE831]
    MKDYTQLTSIEMVREFTRDNRLSFIYISRENCSVCHAVWPRVQELLSDYPQIQLGKVDADEVKEIAGEYLVFTVPTMFLL
    KDQKELFRESRFIRIEQLKENLERAIIDI

    >gi|23097731|ref|NP_691197.1| cadmium-transporting ATPase [Oceanobacillus iheyensis HTE831]
    MSHSQINSSPNVETYRIQGLSCTNCAAKFENNVRKLPGVENAQVNFGASKVYVEGNTTIQDLEKAGSFENLKITNDRERK
    SEKTISFWKQKDNIRLYIAAFIIVISLIASYSLNEQSIIPTIGFGAAILIGGYSLFMKGLKNLIQFQFDMNTLMTIAVIG
    AALIGEWLEGAAVVILFAISEALERFSMDKARQSIQSLMDIAPNEALIRRDNIEQTIDVNDIQINDIMIVKPGQKIAMDG
    IVIKGSSSVNQSAITGESIPVARMTDDEVFAGTFNEDGLLEIRVTKKVEDTTISKIIHLVEEAQAERAPSQAFVDKFAKY
    YTPVIMLIALMVAIVPSAITGDWSTWIYQGLAILVVGCPCALVISTPVAIVTAIGNAAKNGVLIKGGVYLEETGSLQSIA
    FDKTGTLTEGVPHVTDIVSYQGEEGSNLSLIAAIENGSQHPLAAAIIRKANEDNITFKNVEMENFKSITGKGVQATIDNK
    DYYVGSPDFFKELQTSIDPTIVQQIEDMQLEGKTVIILGTHQDILSLYAIADKVRAASKHVVTKLNKLGMSTVMLTGDNQ
    NTASAIGKQVGVTNVKSNLLPEDKLKYIKELTNNDQKTAMVGDGINDSPALAASTVGIAMGGAGTDTALETADIVLMSDD
    LNKLPYTMNLSRKTLRIIKENIIFSLGIKLAALLLVIPGWLTLWLAIFADIGATLIVTLNSLRLLRVKDDV

    >gi|23097776|ref|NP_691242.1| pyridine nucleotide-disulfide oxidoreductase [Oceanobacillus iheyensis HTE831]
    MLDSIVIGGGPAGLSAALVLGRAGKRVVVFDDDNARNKVTHESHGFLTRDGIHPSELKELGKKDILKYPTVSMEMQRVNE
    IHRENNHYQLITENGDLYQTKKVLLATGLKDVFPHVEGLDKFYGSSLFS
    CPFCDGWEMRDQALVVIFE

    >gi|23097987|ref|NP_691453.1| thiosulfate sulfurtransferase [Oceanobacillus iheyensis HTE831]
    MKNLISVQRLMRRFSQNQIVIVDVRFDLQDPDAGRKAYLKEHIPGAIYMDLNKDLSGKAGKHGGNHPLPDWELFANKLGQ
    IGITNETIVVVYDQGNDMFAPRFWWLMDYVGHDKVYILEGGLDQWKEEGGVVTTEIPSLTPVTYHPRMKQNRTVDMKEVR
    DKITNGNTVLIDSRSYPRYLGDEEPLYRRAGHIPGAVNYFWKDVLTSDGTRWKDKEQLENLFANLSKDDEIIVS
    CGSGVS
    ACPNILALEAAGFHNVKLYPGSFSDWISYDENDVKVGEETT

    >gi|23097998|ref|NP_691464.1| peptidoglycan hydrolase [Oceanobacillus iheyensis HTE831]
    MKIEVWSDFVCPFCYIGKRRLEKALDHFEQSNEVTIEYKSYQLDPNAKHIPGKNFYDTFSELKGMPLDQVKNMNQQVKEQ
    ASEIGLDYNFDDMKYSNTFDAHRVAKLATKQNKGKEITERFLHAYFTESELLSDHQTLIRLAEEVGLTPSEVEEVLNTEK
    FTNRVNEDIDIARQIGVQGVPFFVFNEKYAVSGAQPEEVFHEVLTKVWEEEKQNPVLKTIHTGNSKTSFCTDEDCGGE

    >gi|23098025|ref|NP_691491.1| gluthatione peroxidase [Oceanobacillus iheyensis HTE831]
    MSVHDFTVTTIEGEEKRLSDYKGKVILIVNTASQCGFTPQLEDLQKLYKQYQDNDFEILGFPCNQFGNQDPGASEEISAF
    CQKNYGVTFQMFKKVDVKGKEAHPLYKHLTEEKKGILGGQIKWNFTKFLIDQNGNVIERFSPQKNPNTLNKDIEVLLR

    >gi|23098027|ref|NP_691493.1| hypothetical protein OB0572 [Oceanobacillus iheyensis HTE831]
    MESNQEYQVLLYYQYVTIDDPEAFAEEHLRYCKEIGLKGRILVANEGINGTVSGTIEQTTAYMDHMHNDERFHDMTFKID
    PHEGHTFKKMHVRPRPELVTLRLEDDVNPLETTGEYLEPKDFYQALQDENTVVLDARNDYEYDLGHFRGAIRPDIKTFRD
    LPDWVQENKDMLEGKKVVTY
    CTGGIRCEKFSGWLVKEGFEDVAQLHGGIVTYGQDPEVQGDLWDGQLYVFDERISVPVNR
    KEHVIVGKDYFDGEPCERYVNCANPECNKQILASEENEHKYLRGCTHECRVTPRNLYVKEHELTGTQVEERLLAIGESLT
    QEV

    >gi|23098048|ref|NP_691514.1| thioredoxin [Oceanobacillus iheyensis HTE831]
    MEAIKSVESFNEIIASEQPVIIKFYADWCPDCKRMDMFIDGVIEEFNHYDWYEVNSDEVEGLAEKYEVMGIPSMLIFKNG
    EKIAHQHSAYTKSPESVSEFLHQQLD

    >gi|23098189|ref|NP_691655.1| methionine sulfoxide reductase A [Oceanobacillus iheyensis HTE831]
    MTLQKATFAGGCFWCMVKPFDQWDGVHQVISGYTGGKVINPTYEQVKKGNTGHYEAVEITYDDAIIDYNTILDLYWKQID
    PTDDGGQFQDRGEQYRAAIFYHTKEQWGLAEASKEELATSGRFSKPIVTEIKPATPFYPAEEYHQDFYKKNKEEYEEDRA
    KSGRDEFIEDNWE

    >gi|23098191|ref|NP_691657.1| methylated-DNA-protein-cysteine S-methyltransferase [Oceanobacillus iheyensis HTE831]
    MNNVLYYSKITFDNGSIWVLGTDKDIYYIGGYNSGFNDLSLWAKKKYPAYELIGDDQILETAVEEMKSYFDGKLTDFSFE
    VDYSYGTPFQQKVWHALQEVPYGETVTYTDIANQIGRPDAVRAVAGAIGANQLLIAIP
    CHRVIGKNGKLVGYRGGIEMKE
    SLLKLES

    >gi|23098307|ref|NP_691773.1| cytochrome c biogenesis [Oceanobacillus iheyensis HTE831]
    MKILKYVLIISISMFLPIMTAYAEGTEVGERAPDFELKTIDGQQLRLSDFKGERVLINFWTTWCPPCRQEMPDMQRFYQD
    LQPNILAVNLTDTEMNKEQVVRFSQELELTFPILLDEKGEVSKAYRISPIPTTYMIDSEGIIRHKSYGALTYEQMVAEYN
    KME

    >gi|23098314|ref|NP_691780.1| NADH oxidase [Oceanobacillus iheyensis HTE831]
    MSKKIIIVGGVGGGATVAAQIRRTNKTAEILVLERNGYVSFANCGMPYYLGGTITDRQKLIYPEEKFAQKYDLTVQTHAN
    VTKINREQKSVVYEKYKTEHKADYDILILSPGASPVLPDIAGLQQSNTFPLRTIEDMDNIEQFIQSNNPQSAAIIGGGFI
    GLEMAESLCHRGFSCSLVDRSEHVLKRIDKEMAIHIDEHLQEKGIALYVNDGLKSFSDNGTTLHLSSDKTIQADMTIMAI
    GIKPNTELAIDAGLEIGETGGIKVNQYMQTTDPTIFALGDAVEVTDFITREPAHIALAWPAHRQAFIISSFLSGNPISDD
    GIIGSSILRVFDLTVAATGQNKQTLIDNEIAFEETIMKGYSHAAYYPGSKELWMQIVYDKNTGQLFGGSVIGFDGADKRM
    AVLATAIKGKLTVADLASLELGYSPIYSGAKDPLNILGYKAMEQLED

    >gi|23098358|ref|NP_691824.1| bacterioferritin comigratory protein [Oceanobacillus iheyensis HTE831]
    MSVEIGSKVNDFSLPNQHGENISLSDYQGKYVVLYFYPKDMTPGCTTEACDFRDNHESFKELDAVILGVSPDPEARHQKF
    IDKHELPFNLLSDEDHQLAEQFDVWKLKKNFGKEYYGIERSTFIIDKDGKLIKEYRKVRVKDHVSDALEYIKEINEVG

    >gi|23098597|ref|NP_692063.1| copper-transporting ATPase [Oceanobacillus iheyensis HTE831]
    MANKQSTYHITGMTCAACSNRIEKVLNRMDGVEANVNLTTEKASIRYDDSKFTNDDLTKKIEKIGYGIQIEKVDLDISGM
    T
    CAACSNRIEKVLNKMDGVKDATVNLTTETGSIYYYPDLILESDLLNKIKKIGYEATPRSENKENIKQKQIARTKRKLII
    SAVLSFPLLLTMLVHLFNFEIPAFLMNPWFQLVVATPIQFWVGWQFYVGAFKNLRNKTANMDVLVAVGTSAAYFYSLYEG
    LLTINNSAYHPHLYYETSAIIITLVLFGKYLEARAKGQTTTAITKLLNLQAKEARVLRKGTELLIPLEEVVVGDRLIVKP
    GEKIPVDGIVKQGRTSVDESMITGESIPVEKNLDSEVIGSTINKNGSIEMEASRVGTETALSSIVKAVEDAQGSKAPIQR
    LADVISGYFVPVIVMIAILTFFVWFLFVQPNQVEPALVASIAVLVIACPCALGLATPTSIMVGTGRAAESGILFKGGEHI
    EQAYKIQSVVFDKTGTITNGKPVVTDFNGDDETLLLLASAEKGSEHPLAEAITQHAEEKQLDLLSTTDFEAIPGRGITAK
    IDNKHIIVGNRQLMKEYKVDSRKEEEHLLELENEGKTAMLIAIDGKIRGTVAVADTIKENAKEAINQLKDMNIQVVMLTG
    DNERTAKAIGRLAGIDHIIAEVLPEEKAENIKALQKDGTAVAMVGDGINDAPALAVADIGIAIGTGTEIAIEAADITILG
    GDLLLVSKAIKISQATIKNIKQNLFWAFGYNTAGVPIAAIGLLAPWIAGAAMALSSVSVVTNSLRLKKLKV

    >gi|23098619|ref|NP_692085.1| hypothetical protein OB1164 [Oceanobacillus iheyensis HTE831]
    MGKKMIIIISVIVLLFVALIFVVNYKNDQATQDSPYGDKDLEQETIDQLDDPLYQNQIMPDDLSQQIEDGESVTVYFYSP
    V
    CVYCQNTTPYLVPLAEDMDVDMKKLNLYEFDAAWGTFSVDSTPTLVHYEDGEEVARLIGQKPEEEYQAFFEEYVN

    >gi|23098668|ref|NP_692134.1| transcriptional regulator Spx [Oceanobacillus iheyensis HTE831]
    MVTLYTSPSCTSCRKARAWLEEHNIPFTERNIFSEPLSLDEIKEILRMTEDGTDEIISTRSKVFQKLDVNIDQLPMKNLF
    NLIQKNPGLLRRPIILDEKRLQVGYNEDEIRRFLPRTVRTFQLREAQRMVN

    >gi|23098818|ref|NP_692284.1| hypothetical protein OB1363 [Oceanobacillus iheyensis HTE831]
    MTVNIYGASCSSTRKARQWFKKHGIAYKERNILRQPLTINELQEILRMTVEGTDEIISTRSKIFKELNLNLDELPLQKLL
    ELIHEHPRLLKSPILMDEKRFQVGYHEDDIRQFLPRKTREHLWLQWKLDLGLVKG

    >gi|23098859|ref|NP_692325.1| hypothetical protein OB1404 [Oceanobacillus iheyensis HTE831]
    MRINDTMPENLHRQGNWYQGRPIQTKHLLGNPTLIVFWSVSCNSCLVAIRQLSRLQSKYNDAQILFIHTPLMEEDNNLNL
    IRNKSSQFNVHGSKIADRDESLSKLFQVKYVPAFYLFDQQGKLRYIQSGKSNTSLLDNKLARLYRK

    >gi|23098870|ref|NP_692336.1| dihydrolipoamide dehydrogenase [Oceanobacillus iheyensis HTE831]
    MVVGDFPVEVDTLVVGAGPGGYVAAIRAAQLGQKVTIVDKGALGGVCLNVGCIPSKALIEAGHKYENAHGSEDLGIKTDK
    VEVDFSKVQDWKGSVVNKLTSGVESLLKGNKVDIVKGEAYFVDANTAKIAGESSSQTYKFKDCIIATGSSPIEIPSFKFS
    DRVLDSTGALSLKEIPKKMVVIGSGYVGTELGTAYANFGTEITFLEGAKDILGGFEKQMTQLVKKGLKKKGATIITEAMA
    KGVEETKDGVKVSYEVNGKEETIEADYVLVTVGRRPNTDELGLEQMGVKMTDRGHIEIDKQCKTSVDNIYAIGDIVEGPA
    LAHKASYEGKIAAEAISGEKSEIDYVGIPAVAFTEPELATVGLSEQDAKDAGYDVKVGKFPFGANGRALSLNNTEGFLKL
    ITRKDDGLVIGGQIAGPNASDMISEIGLAIEAGMTAEDISLTIHAHPTLGEITMEAAEVALGTPIHTM

    >gi|23098953|ref|NP_692419.1| organic hydroperoxide resistance protein [Oceanobacillus iheyensis HTE831]
    MSDILFTSTATAKNGRDGHVKSNDGIIDVELVNPAKGNTDKKGSNPEQLFAAGYSACYDGALNHVASEKGKKISSETTAD
    VHFMKDPSDGGFKIGATLHIKIEGVSQDEAQELAEAAHDF
    CPYSKATRGNIEVTLKPEAV

    >gi|23099137|ref|NP_692603.1| cytochrome c biogenesis [Oceanobacillus iheyensis HTE831]
    MEAANLFKKIFGFMLLLVLVGLLLGNIIQSNYEDNHSDTDYHVTGDDNMEGGSIAPVDSVGLEPGDKAPDFELETLEGES
    FRLSDYQGKKVILNFWYTW
    CPPCKEEMPEMQEFYDDYKEEVEIVTVNMTEYEKTQQNVQDFIDEYDFTFTVPLDKNSEVS
    DLYTIYAAPSTYFIGTDGIVQQERKIGPMDYEFMQEMVEGIN

    >gi|23099189|ref|NP_692655.1| bifunctional methionine sulfoxide reductase A/B protein [Oceanobacillus iheyensis HTE831]
    MSKQTEIATFAGGCFWCMVEPFDQRPGVIDIRSGYTGGHVENPTYEQVCTNTTGHVEAVQITFDPEIMPYKELVETFWQQ
    IDPTDAGGQFNDRGESYQTAIFYHTEEQKKIAEDSKKALDESNRFKMPIVTPVLPAKPFYEAEEGHQDYYKKRSFHYRMY
    KKGSGRQDFIKNNWQNTIDKNELKEKLTPIQYHVTQENGTERPFDNEYWNNTQEGIYVDIIKGNVLFSSKEQYDAGCGWP
    SFTKPVDPYQIEDKVDKTHGMVRTEIRSKQSDSHLGHVFEDGPQDKGGLRY
    CMNSAAMRFIPKEKMEEEGYSKYLYLFN

    >gi|23099277|ref|NP_692743.1| thiol-disulfide oxidoreductase [Oceanobacillus iheyensis HTE831]
    MDIQQNKTNKQKKKRNRFIFRSSILLILVAAVVFAIVSNMKDDNKIYRVGDAAPDFQLKQISEEVDQSTVQLSDLEGKGV
    MLNFWATW
    CDPCKAEMPYMQDLYAEYKEKGVEIVAVSLDGTELVVDQFIDEYDLTFPVPHDKNGEVKDLYKIGPMPTTYF
    IKPNGEIEEIVQGALTLDRLEGYLNDIAPQQN

    >gi|23099322|ref|NP_692788.1| dihydrolipoamide dehydrogenase [Oceanobacillus iheyensis HTE831]
    MATEYDLVILGGGTGGYVAAIRASQLKMKVAIVEKAELGGTCLHRGCIPSKALLRSAEVYQQTTRADEFGIQVAKPVLDF
    SKVQQRKQKIIDQLHQGVQGLMKKGKIDVYQGFGRILGPSIFSPMPGTISVEYSDGKENDMLLPKNVLIATGSRPNQLPG
    FEFDHNYILSSDDALALETLPDSIVIIGGGVIGIEWASMLNDFEVDVTILENQDRILSTEDAEISKEMSKLLSQKGINII
    TNANVKADSVKKDQGVSLQVDVDGEIQTHQAEKVLMSVGRKGNIENIGLENTDIVTDRNLIMTNEFYQTKESHIYAIGDV
    IGGLQLAHVASHEGIKAVEHMAGHTVEKIKANAIPSCIYSSPEAASIGLTEAQAKEKDYEVKVGKFPFKAVGKALVYGES
    EGFVKIVSDKNTNDLLGVHMIGPHVTDMIAEASLAKFLDATPWEISESIHPHPTLSEVIGEAALAVEGNQIHG

    >gi|23099356|ref|NP_692822.1| hypothetical protein OB1901 [Oceanobacillus iheyensis HTE831]
    MEIIIIALVVLLAVSLFRYYRQKNYLKVLTEDQFREGYRKAQLIDVREPQEFDKGHILGARNIPMTQMKQRLIEMRKDKP
    IYLY
    CQGSSRSARAAQLLHKKGYKEIYQLKGGFKKWTGKIKTKK

    >gi|23099572|ref|NP_693038.1| thioredoxin [Oceanobacillus iheyensis HTE831]
    MAIKHVTDQNFTEETSKGLVLADFWAPWCGPCKMIAPVLEEIDGEMEEKVQIVKLDVDENQETAGKFGVMSIPTLLLFKD
    GDVVDQVIGFQPKEALEDLINKHA

    >gi|23099648|ref|NP_693114.1| thioredoxin peroxidase [Oceanobacillus iheyensis HTE831]
    MSNVTFKNDPVTLLGAEKKVGDSAPDFTVLANDLSKKHLSDYKGKVKVISVVPSIDTGVCSEQTRRFNQEATNLENVQIL
    TISMDLPFAQKRWCAANGIDRVDTLSDHREADFGQKYGVIIEELRLLSRAVFVVDENDKITYVEYLSEVSNHPDYEAVLS
    HLNK

    >gi|23099690|ref|NP_693156.1| thioredoxin [Oceanobacillus iheyensis HTE831]
    MKLLETNEQFESYKQEGPVIFMFTAGWCPDCRIIEPILPEIEQQFNEYQFVEINRDDFIEICQSNNVYGIPSFLAFENGK
    ELGRFVSKDRKTKEEIEHFILSLKE

    >gi|23099756|ref|NP_693222.1| hypothetical protein OB2301 [Oceanobacillus iheyensis HTE831]
    MKYDVTVIGGGPSGLMAALSAAEHGAKTLLIEKGNKLGKKLAISGGGRCNVTNRLPQEEVIRHIPGNGKFLYSAFSIFNN
    YDIIDFFENLGVALKEEDHGRMFPASNKAMDVVNILINELKRLNVTIEMNTKVSSISYGKDQHTIQLDDHTNIQTTAIVI
    ASGGKAVPHTGSTGDGYEWAKAAGHTITKLYPTEVALTSKESFIIEKKLQGLSLRDVNLSVWNKRGKAIITHKMDMIFTH
    FGVSGPAVLRCSQFVVKELMRKRESVTMHLDVLPDKSEQEIRQWVKNQIKNHPKKSFKNSIKGLVPERFMEYLLDKYEVT
    DEQKCANISNEIINDIIHDIKHFTFEVNGSLPMEKAFVTGGGVSIKEIIPNQMQSKVMERLFFCGEILDIHGYTGGYNIT
    SALVTGRLAGMNAAKASITSN

    >gi|23099760|ref|NP_693226.1| hypothetical protein OB2305 [Oceanobacillus iheyensis HTE831]
    MAEIKEISPEEVEEIKDENNVVLVDVREDEEVAQGIIENAKHIKLSDIPHEYENLNKDKEYIMICRSGRRSYNASEFLQD
    QGFNVKNMSGGMLEWKGETISK

    >gi|23099808|ref|NP_693274.1| hypothetical protein OB2353 [Oceanobacillus iheyensis HTE831]
    MIINITESASEQIKEMKKDESDQSHLRFGIKGGGCSGLSYSLGFDEDINEELDVIQNINGIPVVFFNQDIPIIEGTTIDY
    KENLMGGGFSIDNPNAIVSCGCGSSFRTKDKVGTPGDC

    >gi|23099840|ref|NP_693306.1| thioredoxin [Oceanobacillus iheyensis HTE831]
    MICMKEWNKQMERGVIYIYTPFCGTCSVARAMLENIERLHRQDIFYEMNAAVHPEYMHDNQIESVPCLLFVENGEIVERI
    YTFYSTANIYDYLIQYQPELFSNVT

    >gi|23099844|ref|NP_693310.1| arsenate reductase [Oceanobacillus iheyensis HTE831]
    MALKFYWYPNCGTCKKAKKWFDDHQIDYDAIHIVNETPSSDQIQNWINISELPAKKFFNTSGKKYRELNIKDKVNQLSEK
    EIADLLSSDGMLIKRPIVTDGENITVGFKEDSFEKVWK

    >gi|23099895|ref|NP_693361.1| hypothetical protein OB2440 [Oceanobacillus iheyensis HTE831]
    MKNENIYFYTKENCPLCVEAEELLIMMNKQDIPIIKKDIYASDELLEKYQLMIPVIKYNGKELFGHQLNIEDIDRLLNKS
    TT

    >gi|23099924|ref|NP_693390.1| thioredoxin reductase (NADPH) [Oceanobacillus iheyensis HTE831]
    MSEEKMYDVIIAGAGPAGMTAAVYASRANLDTLMLERGIPGGQMANTEDVENYPGFDNILGPDLSNKMFEHAKKFGAAYA
    YGDIKEVEDHGEYKLIKAGSKEYYTRSLIIATGAQYKKLGIEGEEALSGRGVSY
    CAVCDGAFFKNRNLVVIGGGDSAVEE
    GIYLTRFANKVTIVHRRDNLRAQKIIQDRAFDNEKIDFIWDTVAETINGTDGKVSSVTLKNTKTNEVNNFDAEGVFIYIG
    MVPLNQAFLSLGITNDEGYIATNENMETSIPGIFAAGDIRDKELRQIVTATGDGSIAAEAAIKYVEDLEEKIKSK

    >gi|23100033|ref|NP_693499.1| hypothetical protein OB2578 [Oceanobacillus iheyensis HTE831]
    MKFSRHHNHLINETSPYLLQHVNNPVDWYPWGEKAFNKARKEQKPIFLSIGYSSCTWCHNMNRESFMDQEVAALLNQYYV
    SIKVDREERPDIDGLYMKACQMMTGHGGWPLTIIMTDDQVPFFAGTYFPKHQNYGLPGLMDILPTIAKKYAEDPQQIAEY
    MKKVEDALQDTLSKKSNESLTSEDSVRTYQQLNELFDYPYGGFYKEPKFPSPHNLSFLIHYYYKTGDKNALKMVDMTLKS
    IFQSSTWDHVGFGVFRYATDRKWMFPHFEKMLYDQAFLLDVSVDMFLITKDPFYQLKVNEIIQFVKREMTAENGCFYASL
    SADSNGEEGAYYLWSLEEIYSILGEDEGDLFAEAYGIVPVGVHQGKNLPYRSGISLESLASTYGIQVEKVKTTLTKSVDK
    LQKARLLRTAPATDDKILTSWNGYMIAALAKAGSVFQEENWINHAINTMKNLSDILIKDNRWFANYRQGKTNTKGFLDDY
    AAILWGYIELHQATMEIDHLKKAKTIANDMIKLFWDSNDGGFFFVANDAEQLISREKEIYDSPIPSGNSLASIQLSRLAN
    LTGEMSYYSYVDTMMYTFYRELQDEPSGASFFMRNLFLQQDQTKQVIIIGENTEAFFNHIRKRYLPNIHIISATESSSLA
    TLLPNGENYKKVNGQTTYYVCSNFHCNRPTTSIQKALEEVITESKQKGELL

    >gi|23100105|ref|NP_693571.1| hypothetical protein OB2650 [Oceanobacillus iheyensis HTE831]
    MDVRNQSDFEEWKVEGEKLTQKNIPYFELLEGVDGLVSELPSDKDILVVCAKEGSSVMISEMLSEKGIDVFYLEGGMKAW
    SEHVEPIKLGDLNGKGELYQFVRIGKGCLSYMVLSNGEAAIIDSTRMIDKYTTFAKEKEVKIIHTIDTHLHADHISGGRK
    LAEQTGGYYWLPPRDAEEVTFHYERLQDGSQLTVGSSTIDIKAIHTPGHTIGSTSLIIDGMYLLTGDILFIDSIGRPDLA
    GKAKSWGDDLRDSLYNKYKDLSGELIVLPAHFMIMKELNEDGTVAKKLSKLYEENHGLNMDEEAFTKSVTTNLPPQPNSY
    QEIRETNLGKISPDAEQQREMEIGPNRCAIR

    >gi|23100106|ref|NP_693572.1| hypothetical protein OB2651 [Oceanobacillus iheyensis HTE831]
    MEYLKTDHQVDAKGLACPMPIVKTKKAMNNVKAGEIIEILATDQGSKSDIQAWAKSAGHQYLGTIEEDNVLKHYLRKTTE
    VEKEEMIFSRTIDNDELTKKLVDYHTDQSILVDVREQAEYAFGHIPQAVSIPLGEIDNRMDQLDKDKTIYVI
    CRTGTRSG
    MAAQKLIDSGYEHVINVKPGMSQWQGDIRSEL

    >gi|23100234|ref|NP_693701.1| hypothetical protein OB2779 [Oceanobacillus iheyensis HTE831]
    MPTIKTESLYKKSYFSRIQELKEFAPEVFHSFFAFNNKALEEGKLSVKQKELIAVAVAHITGCPYCIELHVGNVKKQGAD
    KEEVTEAIFVATALKAGSSLAHGVNGLNAYDENGDDELYKASYFKRLQELSETSEDAFKAFLTFDGATLEEGKLTVKEKE
    LIAVASAHTTGCAY
    CIDLHTKNAKKAGASKDELSEAIFVAVALKAGSALAHSVNALNAYDDE

    >gi|23100246|ref|NP_693713.1| hypothetical protein OB2791 [Oceanobacillus iheyensis HTE831]
    MKVTTKWIGGRAFTATGDSGYEVNMDATEAYGGLGKGATPTEMLLSSLAGCIGIDVTMILRPHLDKITKIEIETDGTRKE
    EAPKGFTDIVVTFIIDGDIDSKKVWRAINLGEEKY
    CSVSDSLKANISFELILNGEIEKM

    >gi|23100490|ref|NP_693957.1| hypothetical protein OB3035 [Oceanobacillus iheyensis HTE831]
    MAQHHFYLKAEWPGGRNSQGTIDAGNLKTKISIPTEMDGPGIGSNPDEMLLGAAATCYVITLAAMIERAELPLSKMSLES
    EGIVDVTNGVFTYEKIIHKPFVDLKNEASDKQWNHVRKLVEKAETS
    CMISRAIQGNVQIELQPTFGK

    >gi|23100599|ref|NP_694066.1| hypothetical protein OB3144 [Oceanobacillus iheyensis HTE831]
    MEQSVTQKNFMQKQTTILADLNPMQKPLLIIGIIVSIILFSAIVITADWIQGVLFILGLALGATLLYARFGFTSAFRRLA
    SVGNVQGIQAHLLMFVVSTTLFAIILSNGFSFTGVEPQGYVSPVGISVLVGAFLFGIGMQLGNG
    CASGTLYNLGGGGSSM
    IFTLIAFIIGSTLGAYHLPFWTETPSLPPISLAESTGLGFFGGWVVQLLLFGLIYWITLIVAKRKNPPAMKPLAKGSGWK
    LVFRGAWPLFIAGVILAALNALVLLVRGTPWGITSAFALWGGKTLQAVGVDVSSWGYFSGDAANALSQSVLMDSTSVMNF
    GIILGAFIAVTAQGNFKPRKIKPGVAGAAIVGGLLMGYGARLAFG
    CNIGAYFGGISSFSLHGWVWAIMALLGTGVALFLR
    PLFGMMNPNKNDQFC

    >gi|23100607|ref|NP_694074.1| hypothetical protein OB3152 [Oceanobacillus iheyensis HTE831]
    MSVIIYGAACSSTRKAKQWFQKNGIDFEERNVIREPLTVNELQNILRMTVEGTDEIISTRSKIYKDLNLDIEALPLQELL
    EIIQDHPRLLRSPIMVDDKRLQVGYHEEDIRQFLPRQTREYQWLQWKTNNLRVAEN

    >gi|23100648|ref|NP_694115.1| thiosulfate sulfurtransferase [Oceanobacillus iheyensis HTE831]
    MSERNIPLLVTTDWLAERMDDPNLRILDATTFLKQPAQGGYYDVWSGKDVYDKGHIPGAVYADLLGELSDADSPFKFTVP
    HREQFIEKITDLGVGDDTFVVVYDQAQAVVGAPIIGSDWASRLAWQLRYEGFENVAVLDGGFLKWEKEDRPISTEAKPYS
    KGHFTGTRNDDLLATKEDVKNAMEDDNVVLINSLSPADFAGESDTYERSGHIPSSVNVFFGQHSDQDTLQLHPEEQLRET
    FEKVGALDPNKKVITY
    CGSGIAATWNALILNQLGQDNVAMYDGSMTEWANDKDLPLNK

    >gi|23100767|ref|NP_694234.1| NADH oxidase [Oceanobacillus iheyensis HTE831]
    MKVAVIGCTHAGTTAIKNIVNLYPDAEIDVLERNDNVSFLSCGIALSVGGVVENPEDLFYASVPQFERLGVRMHMNHDVI
    SCDVTAKQLQAKDLKTDTIKNYSYDKLIIASGSWPITPPIPGADLENVLLCKNYDHAKEIINRSASVRNVVVVGAGYIGV
    ELVEAFEENGKNVTLIDSEERILNRYLDDIFTEPVEASFEQRGVQLALGQTVSQFEGEETVEKVITDKGEYAADLVVMCI
    GFRPNTGLFNNQLDMLGNGAIVVDAYMQTSVKDVFAAGDCCAIYNNATKQSAYIPLATNAVRMGTLVAHNLVRPVMAHPG
    TQGTSGLKLYHHNIASTGLTESAASLSGVSVDSVVYKDNYRPDFMPENAEIQLKLVYETETHRIVGAQVISDADFTQAIN
    TISVGIANNMTVEQLALTDFFFQPHYNKPVNFLNEVALKAMAKKAGKTQKQAVLS

    >gi|23100914|ref|NP_694381.1| organic hydroperoxide resistance protein [Oceanobacillus iheyensis HTE831]
    MGSALYTASSTASGGRQGTVKSSDGTLDLALSLPKGLGGNEKEGTTNPEQLFSAGYAACFDSALQMVAGQAKKKITSEVT
    AEVSIEKQTGGFGLSVNLIAEIEGVTQEEAEDLMDKAHKA
    CPYSRAIEGNVEVNKNAIGK