Novosphingobium aromaticivorans DSM 12444 uid57747

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|87198028|ref|YP_495285.1| UBA/THIF-type NAD/FAD binding fold protein [Novosphingobium aromaticivorans DSM 12444]
    MTTPALSPALTPDRLDRFARHIVLPEVGAIGQARLAASHVVLVGMGGIGSPALQYLAGAGVGRLTLIDDDVVEASNLQRQ
    TIYTEEDLGKPKAQAAAAWVARFDPALEVVHHVTRIGRENAADLIAGADVVLDGSDNFATRLSVSDACVSVGVALSSVAL
    GRFQGQVANFAGHRPGEACYRCFVGDAFDAEDCDT
    CADLGVLGAMVGMIGAFGAMAAMRVLLEGVSTLGDPQWGQLHVFD
    GLKPSLRTMRIARDPECRGCTSGQ

    >gi|87198037|ref|YP_495294.1| hypothetical protein Saro_0011 [Novosphingobium aromaticivorans DSM 12444]
    MNVTVYGIPNCDTVKKARAWLDARGIAYTFHDYKKQGADPARIAAWIAKAGLDKVVNKAGTTYRKLDDAQKAALGAETAP
    MVLAEHASVIKRPVVEHPGGLLVGFKEAEWAAALA

    >gi|87198181|ref|YP_495438.1| HesB/YadR/YfhF [Novosphingobium aromaticivorans DSM 12444]
    MTSGPVEVGRLRAYLGPMSETAIQTPVTLAPSAAARVAAIAAKQGKPAILRLSVEGGGCSGFQYRFGLADAPEEGDTIAE
    TDGVRLVVDEVSLGLLEGSMVEYVESLGGAAFRVTNPQAASGCGCGASFAI

    >gi|87198184|ref|YP_495441.1| methionine sulfoxide reductase A [Novosphingobium aromaticivorans DSM 12444]
    MRRPVLAAALLAGIVTASCQQTAQAEGAVAAPEAAVQADEAPGRKVAIFAGGCFWGVEGVFSHVKGVTSVVSGYHGGEKK
    TASYDVVGTGRTGHAEAVRVTYDPAKVRYDQLLRIFFAVVTDPTQLNYQGPDDGTQYRNALVPMDKEQARVAAGYLAQLK
    RLDLWKRPIVTAVEPYKTFYPAEGYHQDFMANNPDHGYIRRWDAPKVQALKRMFPDLYKPAFTRN

    >gi|87198227|ref|YP_495484.1| HesB/YadR/YfhF [Novosphingobium aromaticivorans DSM 12444]
    MTTETKVRRPRPAAVILTASAEARIANLMENAPEGAIGVKLSTPRRGCSGLAYSVDYVTEANPMDERIETPGGLFFIDSA
    SVLYLIGSTMDWQEDDFTAGFVFQNPNAKGSCGCGESFTV

    >gi|87198246|ref|YP_495503.1| protein-methionine-S-oxide reductase [Novosphingobium aromaticivorans DSM 12444]
    MMPDADRRRFLALLGAGAVMPLASACSARPAAKGTFPIMHSDAEWRRLLTPEQYYILREAGTERPFTSPLLKEKRKGAFV
    CAADGNALFASGTKFESGTGWPSFWRPLPRAVGTSSDRTLGMVRTEVHCSQCGGHLGHVFDDGPPPTGLRY
    CINGDALKF
    RPA

    >gi|87198254|ref|YP_495511.1| DSBA oxidoreductase [Novosphingobium aromaticivorans DSM 12444]
    MADSQPRRLGAFALIAVLIALVGAVAGWWYESRRTDGESGEDAQLEASLAGAGIDGKERAAIEGLVRSYILDHPEILPEA
    MERLQQREAGARIAPMRGALETPFPGAVLGNPAGKVTLVEFTDYA
    CTYCRQSVKALDALIAKNPDLRVVVRELPIIAPES
    APAARMALAAAAQGKYPAYHKAMFEGPRPSDASIAAAAGAAGLDLAAARAFGARNDVEEELKRNLEMARQLGINGTPAWV
    VGGRLIHGAVPEADLQAAIDDARKG

    >gi|87198291|ref|YP_495548.1| thioredoxin [Novosphingobium aromaticivorans DSM 12444]
    MASMGLNLEEQKAVDRFRSAVVEPSMTKLVILDFWAEWCGPCKALTPVLEKVAAEYADKGVVLAKVNVDEEQFIAAQFQV
    RSIPTVYAMFQGQPVADLTPARTESQLRQYLDQILAKVPVQAGEPAQDVTPLLAMGEEVLAEGDGERAASIFAQIVEIAP
    DNAQAHAGLVRALIAAGQKDEAQAVLDALDPAMAADPVFAQARSALALAEDAPEEGELATLRAAAAERPADMDAQLAFAN
    ALYASGQRDEAAARLLAMVAADREWNEGAAKARLLQIFEATGLEDPWVSATRRKLSTVLFG

    >gi|87198480|ref|YP_495737.1| hypothetical protein Saro_0455 [Novosphingobium aromaticivorans DSM 12444]
    MLRLSRQLDYGKPAPAFALPDVTGKIREIGEFADKPALLVAFICNHCPFVLHILDGFIDFAREYEAKGLQVVAISSNWPD
    DYPDDDYPHMQKLAAERDFPFPYLHDEDQDVALAYNAICTPDFFLYDRDRLLYYAGQFDASRPKINRPPVPGLPPLRTDL
    PVTGEDMRRAVDALLAGDPAPQPQHPSAGCSIKWRPGKDPSWG

    >gi|87198519|ref|YP_495776.1| rhodanese-like protein [Novosphingobium aromaticivorans DSM 12444]
    MPTISPADARALMATGATLIDIREPDEHRRLRIPGARNVPVAKLAPVSGKQAVIYHCKSGMRTAGNAARLSAMSDCPAYM
    LEGGLDAWAAAGLPVEQDRRAPLEIMRQVQITAGALILAGVLLSLTVSTAFVALSAFVGAGLVMAGTTGWCGMARLLAKM
    PWNRRPAA

    >gi|87198589|ref|YP_495846.1| glutathione peroxidase [Novosphingobium aromaticivorans DSM 12444]
    MPDTLAAIPLTRIDGTADSLANHAGKVLLVVNVASKCGLTPQYEGLEALYKARKDEGLEVLGFPANDFGAQEPGSHEEIA
    EFCKLNYGVSFPLFAKADVTGPGKQPLYAALTEAAPTKQGPAQEFRDRLKGYGMTPTEDPEVLWNFEKFVIGRDGEVAAR
    FAPGVTPDDPALLAAIDAELAK

    >gi|87198978|ref|YP_496235.1| protein-disulfide isomerase [Novosphingobium aromaticivorans DSM 12444]
    MKFARALMLAALPLTLGLAACDKKSDATGGEVASAEPIAKIPAPAGKAWTETFSVTPDGGYLLGNPDAPIKLIEFGALSC
    SHCAEFSEKGFPKLRDEYIASGRVSYELRLFLLNALDMPAVLLATCGAPEAVIPLSEQFWAWQPNMFSNLQKDEAAFQQI
    SNLPAEKRFAGIAQLGGLSEFFASRGIAAAQGATCLADTAKATRLATVNDQWGKEYDITGTPTFFLNGSKTGVATWAELE
    PMLQKAGAR

    >gi|87198980|ref|YP_496237.1| protein-disulfide isomerase [Novosphingobium aromaticivorans DSM 12444]
    MIGKSIRAIAGTMIAAGAAVLLMGAGKPAKPAPRANWVASSTVTADGHHLLGNPAAKLRLVEFVSYTCPHCSHFEIESEG
    QLKIGMVQPGKGAIEVRNFVRDPIDMTVALITNCVPPSRFFTLHTAFMRSQAQWIGPLANSTEAQRQRWFNGTFATRTRA
    IASDFRFYDFMAARGMDRSTLDRCLSNEALAKKLAAETDEAINQYNVSGTPSFMIDGILLAGTHDWASLRPQILARLN

    >gi|87198985|ref|YP_496242.1| DSBA oxidoreductase [Novosphingobium aromaticivorans DSM 12444]
    MSAPARVALDLWSDVMCPWCVIGLAQIDKALALLGDEVNATIRFHPFELNPDMPDEGEEQAAHIQRKYGRTPEQSAGVRE
    TLRQAAERAGYSFDYVGEGEAPPAMMWNTRLAHRLLTWALHDFGPEKQMPLKRALFDAHFKERRNVSDPEVLAAIAESVG
    LDRVAALRAMIDPQIDAMVVAGQRQAWDMNVSGVPALVINGKLIVPGAQEPQVYVDLIRKVVAREAAGFA

    >gi|87199200|ref|YP_496457.1| dihydrolipoamide dehydrogenase [Novosphingobium aromaticivorans DSM 12444]
    MAEYDYDVLFIGAGPGGYVGAIRTAQLGLKTACAEGRETLGGTCLNVGCIPSKALLHGSEKFDEARNGTFASYGIKTGAV
    ELDLDAMQAQKADSVKSLTGGIEFLFKKNKVTWLKGYAAFEDAHTVTVAGQKVTAKNIVIATGSSVTPLPGVTVDNDAGV
    IVDSTGALALNRVPQHLVVIGGGVIGLELGSVWRRLGAKVTVVEFLDQLLPGMDGDVRKEAAKIFKKQGMELKLGTKVTG
    VAVNGGTATLTVEPSKGGEASTIEADCVLVAIGRRPNVDGLGLDKIGLELNARGQIETDHDFATKIPGVWAIGDVIPGPM
    LAHKAEDEGIAVAENIAGLTGIVNHDVIPGVVYTMPEFAGVGLTEEAAKERGEIKVGKFPMLANSRAKTNHEPDGFVKVI
    SDAKTDRVLGVWCIASVAGTMIAQAAQAMEFGATSEDIAYTCHAHPTHSEALKEAAMAVTGKPIHM

    >gi|87199412|ref|YP_496669.1| periplasmic protein thiol [Novosphingobium aromaticivorans DSM 12444]
    MTEPKGKRPGLAIWLPLALFGAFFALVIWGLVRPADREVASAFIGKPLPQFSLQPATDDRPGLSTADFRDGKPRLLNVFA
    SW
    CVPCAIESPQLDALARQGVEINGVAIRDRKDDVARFLATNGNPFAKIGKDDLSEVQLGIGSSGVPETFVIDGKGVIRY
    QHIGEIRPEDMGLILGKLKEAAQ

    >gi|87199630|ref|YP_496887.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Novosphingobium aromaticivorans DSM 12444]
    MQPNLDCLIIGGGPAGLTAAIYLARFHLRIAVVDAGGGRAAMIPRTRNHSGFPGGISGRDLLARMEEQAAEFGVVVEQTT
    VEAIDRVDGAFRAVAQGREWIAQTVLVATGVINNRPPILPEVHDRALQQGLLRY
    CPICDGYEVTDRDVGVIGTGDHGRGE
    ALFLRAYTANITLIAPDGPHDLDAEARRELEDVGVRLIDGPCHALRIDGGNIFASTPVAELGFHTIYPALGSKICSDLAR
    SLGAEASEDGCLVIDRHQRTSIEGLYAAGDVTKGLDQISHAMGEAAVAATAIRNDLRARRPLLRRRAAPLTTD

    >gi|87199734|ref|YP_496991.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Novosphingobium aromaticivorans DSM 12444]
    MSIVGTKLKPFQATAFHQGKFVDVSDADVVGKWGVFFFYPADFTFVCPTELEDLAGIYEELQGLGVEVYSVSTDTHFSHK
    AWHDSSPAIGKINYYMLGDQNHTISNNFGILREGVGLADRGTFVTDPDGTIQLVEITPEGVGRNAAELLRKIKAAKYWRE
    HPGQVCPAKWEEGAETLAPSIDLVGKI

    >gi|87199735|ref|YP_496992.1| pyridine nucleotide-disulphide oxidoreductase, class-II, active site [Novosphingobium aromaticivorans DSM 12444]
    MPVLDAATTAQLKAYLGNLRRPIELVATLDDSPKSAEMRSLVEEIVAQSDKVSARFDGTGERVPSFAIRADEGRAQAVFA
    GLPMGHEFTSLILALLHVGGHPPKEDADLLDQVRGLEGPLHFETFFSLT
    CQNCPDVVQALNIMAALNPNVSHVAIDGALF
    KDEVERRQIMAVPTVYLNGELFGSGRMDLAQIVAKLDTNASARAAEKIAAKEPFDVLVVGGGPAGAAAAIYAARKGIRTG
    VVAERFGGQVLDTMGIENFISIQHTEGPKLAAQLEQHVKEYDVDVMNLQRATGLVPAGDDGLHEVKLENGASLKAKTLIL
    STGARWRQMGVPGEDEYRNKGVAY
    CPHCDGPLFKGKRTAVIGGGNSGVEAAIDLAGIVAHVTLIEFDNQLRADAVLQTKL
    RSLPNVTIVTSALTTEVLGDGAKVTGLVYKDRETGQTHTVELEGIFVQIGLVPNTEWLKGAIDLSPRGEIEVDARGATSV
    PGVFGAGDATTVPYKQIVIAMGEGSKAALSAFDYLIRQG

    >gi|87199786|ref|YP_497043.1| glutathione peroxidase [Novosphingobium aromaticivorans DSM 12444]
    MSGPRTIADFKARKPNGEEIDLAEKKGKVLLVVNTASKCGFTPQYDGLEALWRQYGERGFEVLAFPCNQFGKQEPGTADE
    IESFCKVNFGLSFPLMAKIEVNGDNADPLYDWLKSEAPGVLGTKSIKWNFTKFLIDREGRVVRRYAPTDKPESIAGDIER
    LL

    >gi|87199827|ref|YP_497084.1| NADPH-glutathione reductase [Novosphingobium aromaticivorans DSM 12444]
    MAEQEFDYDLFVIGAGSGGVRASRIAASHGARVAVAEEYRVGGTCVIRGCVPKKLLVYGSHFAEELQDAANYGWTVEKMS
    FDWPTLRDAVLKDVDRLNTAYTSTLENNKVERFLERATVTGPNTVRLGGSGREISARYILVATGAWPVMPDFPGNEH
    CIT
    SNEVFHLENLPKRVVISGAGYIAMEFAGIFNALGCHVTVVNRSETILRGYDESLRDRLLQITMARGIEYKFNCPFEKVEK
    QADGSLQVFLAGQPDPLAADIVLVATGRLPKTDGLGLETAGIELGAQGEIPVDDHGRTACDSIYAVGDVTNRVQLTPIAI
    REGHAFADRVFGGKDTSVSYDCIPSAVFSQPPLAGVGLTESQARQAFGGNIKVYSSDFRPMKNIFGHRPERGLYKMIVEA
    TSERVLGIHMIGPEAPEILQAAAIAVKAGLTKADFDATVALHPSMAEELVLMR

    >gi|87199962|ref|YP_497219.1| dihydrolipoamide dehydrogenase [Novosphingobium aromaticivorans DSM 12444]
    MAEQYDVIVLGSGPGGYVAAIRCAQLGLKTAIVERENLGGICLNWGCIPTKALLRSAEVLNHMKHAAAYGLAADNIRADL
    DAVVKRSRGVAKQLNQGVTHLMKKNKITVHMGNGILKSATSVEVTGDKGSETISAKHVIVATGARARDLPFAKADGERVW
    TYRHAMTPKEMPTKLLVIGSGAIGIEFASFYNDMGAEVTVVEMMDRVVPVEDADVSAFLEKALTKQGMKIMTGAGVESLA
    VSASGVKAKIKGKDGKVAEGDYSHVIVAVGIVPNTEHIGLEALGVKAERGIIAIDGYGRTNVKGLWAIGDVTPGPWLAHK
    ASHEGVIAAEAIAAELGNKEVHPHPMDRGNIPGCTYCHPQIASVGLTEAKAKEAGYAVKVGTFPFIGNGKAIALGEPEGF
    VKTVFDAKTGELLGAHMIGAEVTEMIQGYVVGKTLETTEAELMHTVFPHPTISESMHESVLAAYGRAIHI

    >gi|87200012|ref|YP_497269.1| thioredoxin [Novosphingobium aromaticivorans DSM 12444]
    MPTKAVTDASFASDVLGSSKPVLVDFWADWCGPCKMIAPALEEIAEELGDKVEIAKVDIMENTDTASKFGVQSIPLLILF
    KDGQPVAQKLGAAPKSQLKGWLESVL

    >gi|87200020|ref|YP_497277.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Novosphingobium aromaticivorans DSM 12444]
    MTIAVGDKLPDVKIVKATAEGPEAVQSAEYFKGKKVALFSVPGAFTPTCSAKHLPGYVEKAADLKAKGIDEVACTAVNDP
    FVMKAWGAANGSSDVTMLADGNGDLAEALGLTMDGSGFGLGKRGQRFSMVVNDGVVEQLFVEAPGDFKVSSAEHMLENL

    >gi|87200029|ref|YP_497286.1| glutaredoxin GrxC [Novosphingobium aromaticivorans DSM 12444]
    MPNMPKVEMYTKWGCPYCFRAKQLLDGKGVSYEEIDVTMGGPKKTEMLERAPGHTTVPSIFIDGLHVGGSDDLAALNAQG
    KLDMMLGL

    >gi|87200139|ref|YP_497396.1| glutaredoxin [Novosphingobium aromaticivorans DSM 12444]
    MTNAQTPNHLASEPRSHPRSRVATIYRMVMPKHICPYGVKVKHLLERQGYQVDDHWLRTREETDAFKAEHGVKTTPQVFI
    DGKRVGGHDDTRRFLGLKVADPDATSYVPVLAVFAIAAALALAVSFAAFGSIFTPRAAEWFVAFAMALLAMLKLQDVDRF
    ATMFLGYDLLARRWVPYAYLYPFGEALAGVLMAARALEWLSIPIALFIGSIGAVSVFYAVYVQRRELKCACVGGSGRVPL
    GFVSLTENVVMVGMAIWMLSRPMGA

    >gi|87200176|ref|YP_497433.1| hypothetical protein Saro_2160 [Novosphingobium aromaticivorans DSM 12444]
    MIENTLLEQDNRRRRWLRTSAGLAAIIAMSAATGWGVASLAAPAAAPDTAKVREALKLRLPKTPIDAINCKGLGGLCEVA
    SKSTLFYVDRAAKYLVIGRVYDMEARQDLTAARLLALNPDLLASGAARRSNPETQAEADPPPAAASARNSPPRHVPLGKL
    PAKGAITWGPANGPRVVVFSDFH
    CGYCKKLEAELKAIGARVEERPISIFGAESRRDAERVLCSPRPELALHMAYSGLALA
    NPKPCDTSGLDANEAFARAHGFGGTPVIVRPADGAVLEGFRPAAVLRDFLRAGPSLTPTPAPKG

    >gi|87200329|ref|YP_497586.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Novosphingobium aromaticivorans DSM 12444]
    MTKLALTAVTAAFALILSAPASAELPTGARAPDFAAPGALAGKPFSFKLHQALKKGPVVLYFYPKAFTQGCTLEAHAFAE
    ASADFRAAGATVIGMSNDDVATLQKFSTEACRDKFAVASASANLIKAYDVDLKKPDGTSTGLTKRTSYVIGRNGRIVMVH
    SDMDYRDHVRLTLAAVRKLKGGKG

    >gi|87200357|ref|YP_497614.1| thioredoxin reductase [Novosphingobium aromaticivorans DSM 12444]
    MATTHKTRMLIIGSGPAGLSAAIYGARAGMEPIVVQGLQPGGQLTITTDVENYPGFRDVIQGPWLMQEMQAQAEHVGTRM
    MWDTILEVSLDGSPFRAVGDSGDIYEGDVLVIATGAQAKWLGVPGEQEFSGKGVSA
    CATCDGFFYRGKKVVVIGGGNTAV
    EEALYLTNHSPDVTLIHRRDSLRAEKILQDRLFAHPNVKVLWNQKVDSFVGEAGKGLTGVKLVDTVTGAESVVETDGAFV
    AIGHAPATELFKGKLELDESGYIVVQPGTPKTAIPGVFACGDVMDHTYRQAVTAAGTGCMAALDAERFLAELDFKAAQAV
    IA

    >gi|87200409|ref|YP_497666.1| transcriptional regulator Ada / DNA-O6-methylguanine--protein-cysteine S-methyltransferase [Novosphingobium aromaticivorans DSM 12444]
    MIAEDEAWTAVLARDRAFDGRFVTGVLSTGIYCRPSCSARHPRRENVRFFADGEAARAAGLRPCLRCSPDEVSRDERAVL
    MAIEAIKAAGQTLALADLAEQCGYSPTHFQRVFARATGLSPAAYARALQKERMAEVLTGAERVTDAVYDAGFSGPSRFYS
    AAGDRLGMSPSAWRDGGRGVTIRWAVVATSLGPMLVAATDKGVCRLSFNEDSEALRRRFPNADLAEGGEAFERLVGDVVA
    AVEAPGDHSHIPLDVKGTAFQEAVWQALRRIPPGETRSYAEIAAEVGKPGAVRAAGSANGANNVAVLIP
    CHRVIRSDGSL
    GGYAYGLEIKRRLLDKERDAKGE

    >gi|87200532|ref|YP_497789.1| glutaredoxin-like protein [Novosphingobium aromaticivorans DSM 12444]
    MSNTTEERISEIVNGNDVVLFMKGTPLFPQCGFSSKAVAILEHLGVEYATVDVLQDMEIRQGIKSFSDWPTIPQLYVKGE
    FVGGSDIMMEMFQAGELQQVMDDAGVKAA

    >gi|87200566|ref|YP_497823.1| 3-mercaptopyruvate sulfurtransferase [Novosphingobium aromaticivorans DSM 12444]
    MQQAGAQAKMDSLVSTQWLANEMGASDLRIVDATAFLPEHGRNALLEYEACHIPGAVFMDLADLVDSASAVPNTLPPAEK
    FASRMQALGLGDGSRVVIYDDSPIKSATRAWFMLTMFGAQNVALLDGGIAKWKAEGRKCAQGRETLRARHFTVWSDQSHV
    RTKGDVLANLDTKAEQVVDARGAGRFTGEMAETNPAVASGHIPGARNVPYSSLFNADGTWKSPDAIRAIFEAAGVDLSRP
    LISS
    CGSGMTANVVIFALHLIGKDDVSLYDGSWSEWGVDPETPKATGPA

    >gi|87200585|ref|YP_497842.1| heavy metal translocating P-type ATPase [Novosphingobium aromaticivorans DSM 12444]
    MNTLARRSAEPVPAVHTVLAVPGMHCAGCMGKVERALGAVEGVASARTNLTARTVEVIHAPAIETPALVAALAATGFEAQ
    PREIEAEPVSAVKPLLAPLGVAAFACMNVMLMSVSVWSGADGTTRSLFHWVSALIGVPAIVYAGRPFFASAWKVLRHGRT
    NMDVPISIGVTIATGLSFYETLTGGAEAWFDGVLMLLMFLLAGRVLDAMMRDRARSGVDALLRQVATGTMVVDADGSTRW
    VEAKSLEPGMIMRVASGERLAADGAIVRGTSRFDQSLLTGESEPVNAGPGSIVHAGTLNVELPVDVRVTAIGRDTALSEI
    ARLMEAAGQSRSKYVRIADRASRLYAPAVHTLAALTFVGWMIAGAGVYKSLVIAIAVLIITCPCALGLAVPVAQVVAAGA
    LMKRGVLVKDGSALERMAEVDRLLLDKTGTLTLGRPVPDEAALDALSGAEASVALALASHSRHPLSLGLVQALGARGVLA
    AALEDVVEEPGKGVSGKWNGLAVSLGRPQSAQGMATALHVEGGPVRVIAFADRLRPDAEAALGQLSSMGVPASILSGDSI
    PAVAAVSRATGLTAQAAASPMEKQEAIERLQAAGRTVLMAGDGLNDGPALAAANASIAPGSASDVGRQAADMVFTGDSLL
    AIPRAVRVARATMRVVRQNFVLAIGYNALAVPLAILGHVTPLIAAIAMSTSSLVVVANSLRLAGEAK

    >gi|87200691|ref|YP_497948.1| thioredoxin family protein [Novosphingobium aromaticivorans DSM 12444]
    MAALAVAGCDRQAAPDSQPQSSTAPAESAAKGEFNGTLDIASRGKEMPDFTVTDPSGKTLKLRDLKGTPVLVNLWATWCG
    P
    CVLEMPMLDKLAADNDGRLRVLTISQDIEGAAKVAPFYAERKFAKLEPWLDPENNLGFHYETGMLPTTVLYDKDGKEVW
    RMIGAHDWSGSRTAAMLAETLGK

    >gi|87200804|ref|YP_498061.1| cytochrome c biogenesis protein, transmembrane region [Novosphingobium aromaticivorans DSM 12444]
    MPIRELVGIKTRLDPLGRIIAMLVTAMCLSLLAWLSPVHAAPNRMTASLVAEGPVRPGETVTLALLMQPEKGWHGYWSNP
    GDAGFGLTVEWTLPAGVTAGDMQFPVPQTLVVQGLMNHVYEHDYAVLVPLKVPSSARSGTLLPIRVKAQWLVCTETICVP
    ERAELQGAVSVGTGPADPRFEGWRAAMPAPLDRPGAFALESGTLRLALPFPATAPLDAPHLFLKTERVVDYAAPQRFFRQ
    GDTLVVEVPLAKSPATASRLEGVLAMGRDAGGIAFAAEPGTVPKGGTQVGAGAFSASVLALALAGAFLGGLILNVMPCVF
    PILSLKALALARGNAHEAHKEGLAYTAGVVLACLLLGGVMLALRAGGEQVGWAFQLQEPGVVAVLMLLAVAITANFAGLY
    ELPGLSVERGAGATGAFGTGLLAAFVATPCTGPFMAAAMGAALVLPAWAALGVFAALGLGLALPFLLLGFVPALRRLLPK
    PGKWMERFRRWMALPMGLTALALGWLAWRVGGATFTVVLVAIAVVLLGALAAVGVTQRKGLPIGRLMALAALIAVGGVIG
    LPPPAQTAASEGGLLEARPFSEAALAEARKAGKPVFAYFTADW
    CLSCKVNESTSIERESTRAAFEKAGVVVLVGDWTRRD
    PAITRFLTAQGVAGVPLYMWYPAGGAEPRQLPQVLTPDMLAALPGQ

    >gi|87201092|ref|YP_498349.1| glutathione S-transferase-like [Novosphingobium aromaticivorans DSM 12444]
    MWQLYQFPLCPFSRKVRLLLSEKGVAYDLVRENPWERREGFGHLSPAYRTPAIHNPERGITLADSRAICEYFEETVDKTP
    MINGTAANRAEIRRLVALFDESFFADVTSPLLEERMKKRLVYRSPPDSKLLREAMRLADEHLYYIDYLIDNRPWLAGSTM
    SLADLAAAAQISVADYLGGIDWSGHEQARGWYSVFKSRPSFRPLLGERMDVIQPPSHYADVNA

    >gi|87201107|ref|YP_498364.1| peptide methionine sulfoxide reductase [Novosphingobium aromaticivorans DSM 12444]
    MSEQATAILAGGCFWCTEAVFRDVIGVSNVESGYIGGTVESPTYKQVCSGSTGHAEAIRVTFDPQVIGYGQILDIFFATH
    DPTQLNRQGNDIGTQYRSALFPLDDEQRSEAKAAIGRAQPDWPRPIVTTIEGPATWYPAEDYHQEYWEGEGQRNPYCLAV
    IPPKLMKLRKSFANKVKA

    >gi|87201167|ref|YP_498424.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Novosphingobium aromaticivorans DSM 12444]
    MSERIGVGEAFPDIAMTTPDGGSVKASDFAGRKLVVFFYPKDDTPGCTTENKDFSSLHADFEAAGIAVLGVSKDPPKKHL
    KFAEKHALTAPLASDAEEGGVSDALGIWTEKSMYGRTYMGMERTTYLVGADGKIAQIWNKVKVKDHAAQVLAAAKAL

    >gi|87201291|ref|YP_498548.1| arsenate reductase [Novosphingobium aromaticivorans DSM 12444]
    MKATIWHNPNCGTSRNTLAMLQEAGADVTVVEYLKTPPGADKLAQLYRDAGITPQQGLRLKGTDAEERGLPGADDATVLA
    AMAAEPRLIERPLVETDKGVRLCRPKEKVLEII

    >gi|87201340|ref|YP_498597.1| protein-methionine-S-oxide reductase [Novosphingobium aromaticivorans DSM 12444]
    MSDQPDKLNLTDAEWRERLSPEQYAILRQGGTERAFTGAYEKNKAEGDYHCAGCGAPLFASDTKYDSGSGWPSFYAPVDP
    EAVDEHRDVSHGMVRTEVRCARCDGHLGHVFPDGPNPTGLRY
    CMNSASLDFTPKD

    >gi|146275469|ref|YP_001165630.1| glutathione S-transferase domain-containing protein [Novosphingobium aromaticivorans DSM 12444]
    MKLFISPGACSLAPHIALRETGATFDAVKVDLATRKVETGDDFLTVNPSGKVPALTLDSGETLTENPAILLYIADQKPEA
    GLAPRDGTMDRYRLLSRLSFLGSEFHKAFVPLFTPGTSDEAKAAATTAVKNHLTAVDKDLAGKEHYVGADFSVADIYLFV
    MLGWPAHVGIDMSAYPALGAYCGRIAQRPAVGAALQAEGLI

    >gi|146275614|ref|YP_001165775.1| hypothetical protein Saro_4008 [Novosphingobium aromaticivorans DSM 12444]
    MKLKSLKSFHLARPRLGQVLMPLAAIALGSGGSLVWANAGTGDAATAQHAPSEADQAVTALLKQRLPRTQVSRVNCQVVD
    GVCEVTAGSQLFYVDKTARYLLIGRVYDMQTRQDLTAVRLLEVNPDLLVGGAAGSKQEAQEVETPRRGVSTPAASGAPRM
    MSLAALPEAGGIVWGANSGPTVTVFSDFR
    CGYCRALSGVLENMNVRVIERPISVLGSRDLANQVFCARDRRKAVKAAYAG
    APITDTRACDTSPLDANEAFARQQGLAGTPVIVRSDGAVIEGFRPREVLEQWLKGAKS

    >gi|146275677|ref|YP_001165837.1| thioredoxin [Novosphingobium aromaticivorans DSM 12444]
    MPDPMILVCPHCTTANRVPQAKLAERGTCGRCGKPLFTAHPVTLTAANFDAHASRSDIPLLVDFWASWCGPCRTMAPAFE
    AAAAQLEPYVRLGKLDTENEQALAGRFGIRSIPTIALFAKGREVARQSGAMPVNAIVAWTRQALTRG

    >gi|146276045|ref|YP_001166205.1| methylamine dehydrogenase accessory protein MauD [Novosphingobium aromaticivorans DSM 12444]
    MTNAVIAALIALWVLVIGLCLVVFALLRQVGMLHERLGPVGALVMPGGPAVGDAAPAFDLAAVDGRAVRIGGASPAPLTL
    LFFLSPT
    CPVCKSLLPVIRSIERERRGALQVVLASDGDLPAQLAMVKREKLEAFPLVLSTPLGLSYQVSKLPHAVLIDAA
    GIIVAKGLINNREHLESLFEAHRMGVGSLQELAARDLAEAAE

    >gi|87199704|ref|YP_496961.1| hypothetical protein Saro_1687 [Novosphingobium aromaticivorans DSM 12444]
    MLTSQILLWTAVIVEGLLIAALARQVGILHERIAPAGALTLHQNVKIGETASPMTVTTIEGAPVEIGGKRDGRSQLLFFA
    SPD
    CPVCKSLLPVVRSAATAEADWLDIVIAGDGSKAEYQRLRDLNGLENVPTVLSEALGRAFGVSKLPYAVLLDEAGRVA
    SLGLVNSREHLESLFEAKERGVASIQDFLARRQKEA