Nostoc punctiforme PCC 73102 uid57767

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|186680732|ref|YP_001863928.1| thioredoxin domain-containing protein [Nostoc punctiforme PCC 73102]
    MSTDSPVNSSDKSESSLGKRLRNFLVVMVAIALSVALVLGLRTETTSASLAKLSNSSTPLEVAVSNGKPSLVEFYADWCT
    V
    CQKMAPDITQLETEYADKMNFVMLNVDNTKWLPEMLKYRVDGIPHFVFLSQQGETIAQAIGDQPRTIMASNLEALVTGS
    SLPYAQASGKVSKFSAPVAPTASQDDPRSHGSQVVN

    >gi|186680871|ref|YP_001864067.1| nitrogenase-associated protein [Nostoc punctiforme PCC 73102]
    MARVIFYSKPGCKGGVKQKVLLTAAGHEVIPQNLLKEAWTAERLRSFFGDRPVVEWFNLSAPKIKSGEVVPEKVDEQTAL
    ALMLKEPLLIRRPLLEVGDRREVGFDVQKIDTWIGLQAVDESLQEISDKLLKQDLQNCSHGKDHNHGQGSQQHQKQGNCK
    H

    >gi|186680910|ref|YP_001864106.1| iron-sulfur cluster assembly accessory protein [Nostoc punctiforme PCC 73102]
    MAVILSEKAEFHLRAFLKGSAPDADGATKGVRISVKDGGCSGYEYAIDITSKPQPDDLVSHQGKVVVYVDAKSAPLLDGV
    IVDFVEGVMESGFKFINPNATDTCGCGKSFKTDDGTPTGVPCS

    >gi|186680911|ref|YP_001864107.1| UBA/THIF-type NAD/FAD binding protein [Nostoc punctiforme PCC 73102]
    MVNLTPTELERYRRQMMLPNFGETAQKRLKSATVLVTGVGGLGGTAALYLAVAGVGRLILVRGGDLRLDDMNRQVLMTDD
    WVGKPRVFKAKETLDAINPDVQVEIVHDYITPEHVDSLVQSADMALDCAHNFTERNLLNEACVRSRKPMVEAAMNGMEAY
    LTTIIPGVTPCLS
    CLFPEKPEWDQRGFSVLGAVSGTLACLTALEAIKLITGFSQPLLSQLLTIDLNRMEFAKRRSHRDRS
    CPVCGNSAPWRHAQSNSMEPTATGIAQNT

    >gi|186681017|ref|YP_001864213.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nostoc punctiforme PCC 73102]
    MPLAVGTDAPAFTAKDTNGNTVSLSDFAGKTVVLYFYPKDDTPGCTKQACSFRDAQSEYQGKDIVVLGVSADDEVSHQAF
    TQKYNLNFPLLADYDKSLITAFDVDGGGYAKRVTYVIDPNGKITHVDNAVNTTTHASDILAALGL

    >gi|186681025|ref|YP_001864221.1| iron-sulfur cluster assembly accessory protein [Nostoc punctiforme PCC 73102]
    MTQAIQSQQRGILLSEAALHQVKSLRDKQGTDFCLRVGVRQGGCSGMSYMMDFEDTSKITPQDEVFDYDGFKIVSDRKSL
    LYLYGLMLDYSDAMIGGGFQFTNPNANQTCGCGKSFGV

    >gi|186681031|ref|YP_001864227.1| heavy metal translocating P-type ATPase [Nostoc punctiforme PCC 73102]
    MQLVPKTKLAPELGPILEKIILDVGGMKCAGCVNAVERQLTQHPGVKSACVNLATEVAVVESETGAVDADALAQRLTAVG
    FPTQPRKARATVAGEISTLPDPAERQRREMRSSVRQLAIAAMLLLLSGSGHFGNLGSSVLPLLNNIWFHCGLATVALLIP
    GRPILVDGWLGWRRNAPNMNTLIGLGTLTAYIASLVALLFPQMGWECFFDEPVMMLGFILLGRTLEQQARGRAAAAFRKL
    LALQPQVARLIANPEKGGVGSSSVEIPAEQVRVGEWLQVLPGDKIPVDGEVVLGQTTVDESMLTGEAVPVIKQPGDSVTG
    GTLNQSGAIAIQTTRTGSDTTLAQIVALVEAAQTRKAPVQKLADTVAGYFTYGVLTASLLTFVFWYFFDTHLWTDIAMSG
    EMEMMSHAIHQAPRSPLLISLKLAIAVMVVACPCALGLATPTAILVGTAMGAERGLLIKGGDVLEKVHQLDTVVFDKTGT
    LTTGHPIVTDCLLISETGSGNPYSLIQLATAVESGTHHPLAKAIQQEAQRQKLSIPEAVDFHTEPGLGVSAVVEDTVVLL
    GNWDWLSWHGISISETAQQVAQDLATDGKTVVCVAVGGTLAGLIAVSDTLRPDAQSTVDKLRQMGLRVMLLSGDRLEAAS
    AIAKQLGLDSADVIAGVPPAKKAAAIKNLQQAGTKGTPNSSLLTQHSVVAMVGDGINDAPALSQADVGIALHSGTDVAME
    TAEIVLMRDRLNDVVESIQLSRATFNKIRQNLFWAFAYNTVGIPLAAGVLFPSLGFVLNPSGAAALMAFSSVSVVTNSIL
    LRRLARHS

    >gi|186681049|ref|YP_001864245.1| rhodanese domain-containing protein [Nostoc punctiforme PCC 73102]
    MNTKALISPQELTSLLAENLSRAVIIDTRSPEDYAISHIPQSINIRDFFTYLLESSYPAGLKELQEYFAVIMSKLGISGA
    ERLIVYEDTLNRGYGQSCRAAFLLKYLGCAEVSILQGGYRAWLTEGLPTTDEVPLCESSIFRFHPNTDMMVTTPEMLQAI
    DNPAIIKLDVRDRSEWLGLSSSPYNPDFCPRKGRIPNAVWLEWHHLMNSKSEIPTFRSPDEIREICQSVGITSESIVYIY
    CFKGSRAANTLIALEQVGISARNYFGSWNEWSRDFSLPIDSRVISM

    >gi|186681171|ref|YP_001864367.1| thioredoxin reductase [Nostoc punctiforme PCC 73102]
    MSLYMVMTNPTVENLVIIGSGPAGYTAAIYAGRANLKPVVFEGFQAGGLPGGQLMTTTEVENFPGFPQGITGPELMDQMK
    AQAERWGAELYTEDVISVDLSQRPFTVRSQEREIKTNSIVIATGATAKRLGLPNEHEFWSRGISA
    CAICDGATPIFHGAE
    LAVIGAGDSAAEESIYLTKYGSKVNMLVRTDKMRASKAMQDRVLSNPKIQVHWNTEAVDIYGNGHMEGVKVRNTKTGEES
    KLHAKGLFYAVGHTPNTSLFKGQLELDEVGYVVTKPGSVETSLEGVFAAGDVQDHEFRQAITAAGTGCMAAMLAERWLSA
    SGLIQEFHQQPEIADNELEHQPAKKTEAEEEAGFNLDETRHQGGYALRKLFHESDRLLLVKYVSPG
    CGPCHTLKPILNKV
    VDEFDSKIHFVEIDIDKDRDIAENAGVTGTPTVQLFKNKELVKEVKGVKQKTEYRQLIESNL

    >gi|186681385|ref|YP_001864581.1| glutathione reductase [Nostoc punctiforme PCC 73102]
    MTFDYDLFVIGAGSGGLAASKRAASYGAKVAIAEYDLVGGTCVIRGCVPKKLMVYASHFPALFSEASGYGWKVGNAELDW
    EYFITSIDKEVRRLSQLHINFLEKAGVELFSGRATLLDSHTVEVDGRKVTADKILIAVGGRPIKPDLPGMEYGITSNEIF
    HLKEQPKHIVILGAGYIGTEFACIMRGLGSEVTQITRGDKILNGFDEDVRTEIEEGMTNHGIRLIKNNVVKTVERVAEGF
    KLTLSGEDQEPIIADVFLVATGRTPNVDGLGLENAGVDVVASSIEGPGYPTTSAIAVNEYSQTNQPNIFAVGDVTDRINL
    TPVAIGEGRAFADSEFGNNRREFSHKTVPTAIFSNPEAATVGLTEAEAREKLGDAVTIYRTRFRPMYYTLTGKQEKTMMK
    LVVDSNTEKVLGAHMVGDSSAEIIQGVAIAVKMGATKKDFDATVGIHPSSAEEFVTMR

    >gi|186681388|ref|YP_001864584.1| rhodanese domain-containing protein [Nostoc punctiforme PCC 73102]
    MPNNQFVISPAWLFEHLEDPQVVIVDCRFSLADPQLGQQQYQTSHIKGSYYLDLNQDLSSPVGKHGGRHPLPEPNDIANK
    FAAIGVNYQKTLVVAYDDSRFAFASRLWWLLRYLGHEQVAVLDGGFTGWQKAGYPVTDVVPQPQIGTFVAELQPEKVVDI
    NVVKTRKDNHEVVLVDSRESDRYRGEREPIDKIAGHIPGAVNYPWQEVTDSSGYLLPQEEQRCRWEQLETAEEILVY
    CGS
    GVTACVNLLSLELAGINKGKLYAGSWSDWISYL

    >gi|186681404|ref|YP_001864600.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Nostoc punctiforme PCC 73102]
    MAFDYNLFVIGAGPGGLAAAKKAASYGVRVAIAEQESIGGTCVNRGCIPKKLIVYAADFALQKQIAPSYGWSECQTYFDW
    TLFIKSVHQHLDTLNQSYFQQLHKAGIELISDRATFIDAHTVDINGLKVTADKILIAVGGQPLKPKIPGIEYAITSREMF
    QLPYLPKRLAIIGGGYIGVEFSSMMHAFGCQVTVIEKDEMILSGFDDEIRSAVEQGLRKRGIKLLTSSTVQEIKYSDESL
    LLTITGKKREIITADTILVATGYAPNTKNLGLENAHVELGEHGAIKVDEYSRTTQENIFAVGDCTSRVQLSPVAKAEGIA
    FANTVFGNKVQKLDYDYVPSAVFCRPEAAGVGMTEAKAREKFGESVQCYYTQFQPLLYQLTDQNEPTTMKLVLNGDSGQV
    LGAHLVGEHAADIIQSLGVAIRKGITKEDLDEIIGIHPTVGEEFFSLDRVQE

    >gi|186681736|ref|YP_001864932.1| DSBA oxidoreductase [Nostoc punctiforme PCC 73102]
    MLIDIFHDTVCPWCRIGKKHLFDALAKWQEQEVHIRWHPFLLDDTVPAEGYEFRNFMQNRKGIKAEELQHLFDYTQREGE
    AAGVKLDFEKIRLAVNTKLAHQLIALAPTNIKNDVVEAIYRAYFEEGLNIGDINVIVAIGTAYQMNATELKLQLNDRDVV
    DAVVAESAFARLNGINSVPFFIMNNQVKVNGSHSVEVFLEALNSTALLDIPAKI

    >gi|186681895|ref|YP_001865091.1| copper-translocating P-type ATPase [Nostoc punctiforme PCC 73102]
    MDTLTLKLRGMSCAGCANNIEKAIRSVSGVIDCNVNFGAEQAAIRYDRSLASLEKIQTAIAAAGYSSDSLQSELLSEEDD
    TEIASRQALQRELFLKVIVGGVISIFLFLGSLPMMTGLNFPLIPSFLQNPWVQLALTTPVIFWCGGSFYRNGWKSLKRHT
    ATMDTLIALGTSAAYIYSLFVTVFPNFFIVQGLIPHVYYEVAAIVITLILLGRLLENRARGQTSEAIRKLIGLQARDARV
    IRDGREIDVPIAEVRINDVILVRPGEKIPVDGEVIAGDSTVDEAMVTGESLPVKKQPGDEVIGATINGAGAFQFRVTRVG
    NDTFLAQIVKLVQQAQGSKAPIQRLADRVTGWFVPAVIAVAIATFVIWFNFTGNLTLATMTTVGVLIIACPCALGLATPT
    SVMVGTGKGAENGILIKGADSLELAHKIQTIVLDKTGTLTQGKPTVTDFVTVNGTANGNEIKLLQLAATVERNSEHPLAE
    AVVKYAQSQEVSLIEVKNFQANAGSGVQAVVSNQLVQIGTQRWLTELGINTMTLQQYKDTWETAGKTVILIAVDGELQGI
    MGIADALKPSSAAVVKALQKLGLEVVMLTGDNRKTADAIAAEVGIERIFAEVRPDQKAAIIQSLQGEIKKSPNSKSKIVA
    MVGDGINDAPALAQADVGIAIGTGTDVAIAASDITLISGDLQGIVTAIQLSHATINNIKQNLFFAFIYNVIGIPIAAGIL
    FPIFGWLLNPIIAGAAMALSSLSVVSNALRLRKFQPKATS

    >gi|186682254|ref|YP_001865450.1| methionine sulfoxide reductase B [Nostoc punctiforme PCC 73102]
    MTTSNSGFEITKPEEEWRTILTPEQFNVLRKHGTERPHTSALDKEYDKGTYYCAACELPLFTSDTKFNSGTGWPSFFNPI
    EGAIATTVDKSLFMTRVEVHCSRCGGHLGHVFDDGPAPTGKRY
    CMNGVSLKFTPA

    >gi|186682302|ref|YP_001865498.1| methyltransferase type 11 [Nostoc punctiforme PCC 73102]
    MTYLETAAQFYREVAETPQVGLCCVQSTPLQLPGLKIPLAMQEMNYGCGTTVHSTELGNQPTVLYVGVGGGLEALQFAYF
    SRYAGAVIAVEPVGAMREAAARNLEIAAQEDPWFDTSFVEIREGDAFNLPVADASVDIVAQNCLFNIFEPEDLNRALKEA
    YRVLKPGGRLQMSDPIATSQIPAHLQQDERLRAM
    CLSGALTYQEYTERITNAGFGQVEIRARRPYRLLDSQTYNLDEHLL
    LESLDSVSFKVDIPEDGACIFTGKTAIYAGSEPFFDDSAGHLLQRGIPAAV
    CDKTAAKLAAIKPAEIIVTNSTWHYIGGG
    CC

    >gi|186682371|ref|YP_001865567.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Nostoc punctiforme PCC 73102]
    MEVDTQHYDDIIIGGGKAGKTLAPALVADGRKTALVERSLNMIGGGCINIACIPTKTMVASANVANTVRNSAAYGVKANT
    PIVDLAEVIQRKRAVVQSAREMNLHNLETALDKNLIIGEARFVAPKTIEVTTTEGKNRLLTAERLFINTGTRPLIPSIPG
    LTEVEFLTSESIMELEYLPEHLIVLGSGYIGLEFAQMFRRFGCGVTVIGQSEQILSQQDPDIAIAVQTLLERNGIEFLLK
    AKVLRVVRKASPLENRTGNETILQIQVGDREITLQGSHLLVAVGRAPNTDSLNLAAAGVATDTRGFIQVNDRLETNIPGI
    WALGDINGGPQYTHISLDDYRIIKANLIDGGDRSTGDRLVPSCLFIAPELAHVGLTETEAQQQGYAIRVAKIDASAVPRA
    RTLGQTDGLLKAIMDTETGRILGCSLLCHEAGEVISTVQMVMQAQMPYTILRDGILTHPTMTEGLNILFSKL

    >gi|186682394|ref|YP_001865590.1| hypothetical protein Npun_F2020 [Nostoc punctiforme PCC 73102]
    MLNPNLDEIQLTKDDYERYSRHLILPEVGLEGQKRLKAANVLCIGTGGLGSPLLLYLAAAGIGRIGIVDFDIVDTSNLQR
    QVIHGTSWVGKPKIESAKNRIHEINPYCQVDLYETRLTSENALEILQPYDIVVDGTDNFPTRYLVNDACVLLNKPNVYGS
    ILRFEGQATVFNYQGGPNYRDLFPEPPPPGMVPS
    CAEGGVLGILPGIIGLIQATETVKIILGQGNTLSGRLLLYNALDMK
    FRELKLRPNPIRPVIEKLVDYEEFCGIPQAKAEEAKQQLESQEMTVKDLKELLDSGAKDFVLLDVRNPNEYEIAKIPGSV
    LVPLPDIENGNGVAKVKEILNGHRLIAH
    CKMGGRSAKALAILKEAGIVGTNVKGGITAWSREVDPSVPEY

    >gi|186682563|ref|YP_001865759.1| peptide methionine sulfoxide reductase [Nostoc punctiforme PCC 73102]
    MSIHNFTPSRQLLRNLSIISLTFVLLYGASRVMLSAPATDISNAAPQGKQVAVFAGGCYWGMEAVFEHLLGVSDVVSGFS
    GGDARTADYTLVSAGLTNHAESVKITYDPSKISYNQLLKVYFLVAHNPTELNRQGPDSGKQYRSAIFFANDEQKQAAQEY
    IAQLNKSRVFDKPIVTELDPLKGFYQAAAYHQNYIVHHPSDRYVVVNDLPKLAKLQAKFPDMYSK

    >gi|186682564|ref|YP_001865760.1| peptide methionine sulfoxide reductase [Nostoc punctiforme PCC 73102]
    MQNANLQKATFGAGCFWGVEAAFRQVKGVTSTAVGYSGGHLDNPTYEDVCRGKTGHAEAVEVEYNPAIVSYDQLLNVFWN
    KHNPTASNHEELNVGYQYRSVIFFHTPEQELLVRASKEQLENSSRYHKNPIVTEILPASQFYRAEKYHQQYLEKHGRASY
    RIG

    >gi|186682663|ref|YP_001865859.1| thioredoxin [Nostoc punctiforme PCC 73102]
    MATKKQFNSFEEMLSASDVPVLVDFYADWCGPCQMMVPILEQVNLQLKDRLRIVKIDTEKYTDLATEYKIASLPTLVLFK
    QGQPVDRIEGVMQAPQLVQYLQTKI

    >gi|186682666|ref|YP_001865862.1| glutathione S-transferase-like protein [Nostoc punctiforme PCC 73102]
    MSIQDTVSNWEELLEIAKKNTPARRVRRPGQSPSTAPIPSSLHKLPPDTEPPVLLYRDTNSWCPFCERVWFALEEKEIPF
    ATEFIDLTNKPKWYTDLVPTTLVPAARIEGKLVYESKDILLALEEQFGSTLLPEDPEENAVARLWLEEAETNGVRDIAYK
    FLRQAPEDPNELASLQTAFEAKLDELEQLLGKYSGPYFLSTFSLVDITYSPHLDRLAANLPVYRGYHLKGNPRYPRINAW
    FEALKQRPAYHRVKSDDTTNNLLLRRRWGVIPISNPLPPDPEISQEIQFRAEAAERLTDNREVALGDILKNSGVQTLAVN
    GDTTAVKEAVDFHLRLLADYLINGNGAALPWGRVGGKDNADPTIAAVGAITLAYVRNRICAPRDMSAGAATAFRAAADKV
    LASLY

    >gi|186682733|ref|YP_001865929.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nostoc punctiforme PCC 73102]
    MISRRTFLNILFASCISVISWLNFIPAADALGGKLPAINQPAPEFTLPTNTGDGKISLSDLRGKWLVLYFYPKDFTSGCT
    IEARRFQQDLPQYLAKNTQIIGVSADDIDSHAKFCDSEGLKFPLLADTDGSVSKAYGSWLGFLSMRHSFIIDPQGVLRET
    FVKVNPTVHSSEVLARLEKLQSTAS

    >gi|186682832|ref|YP_001866028.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nostoc punctiforme PCC 73102]
    MALTASTMLPLGTKAPDFNLPEVVSGKATSLSTFADKKALLVMFICRHCPFVKHIQQELVQLGKDYFTSDLAIVAISAND
    AKNYPDDAPESLQAFATEQGFNFTLCYDESQETAKAYTAACTPDFFVFDEQRKLVYRGQLDDSRPSNGKPVTGADLRAAI
    EAVLAGKPVTSDQKPSVGCNIKWKPGNQPSYFG

    >gi|186683013|ref|YP_001866209.1| putative glutathione S-transferase [Nostoc punctiforme PCC 73102]
    MSNSTPMDDEKNLPKKKGRTLPPKLIIWLGKFVWTTMWQIMMSKLAPSNQSGAYIRPNSQFRKFIGTEEGNPHPPAAGRY
    RLYVGLG
    CPWAHRTLVVRSLKKLEAVISVCIVSPSPIEGGWIFNEEEEGCRTLAEFYQLAEPGYSGRSTVPILWDNQTKT
    IVNNESSEIIVMLNSEFNEFANNPTLNLYPEALKEKIDWWNEKIYHAVNNGVYRCGFAQTQEAYNQACNELFGTLDEIDI
    ALQTSRYLCGDNLTLADVRLFTTLFRFDSAYYGLFKCNRQRIRDYHNLGAYLRDLYQLPGVADTCDVESVKRDYYGNLFP
    LNPGGIIPDGPDMSYLYEPSGRDRIGTLNAS

    >gi|186683152|ref|YP_001866348.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nostoc punctiforme PCC 73102]
    MPIKVGDTAPNFTLPAQNGSTVSLQDFRGTKAVVLYFYPKDDTPGCTAESCAFRDQYEVFKSVGAEVVGVSADSSESHQK
    FAAKYNLPFTLLTDKGDQVRKLYGATAAFGLFPGRVTYVIDQQGVVQYVFDSMLNFKGHVEEALKTLQQIAK

    >gi|186683200|ref|YP_001866396.1| signal transduction protein [Nostoc punctiforme PCC 73102]
    MIDEQEIEKLWQAFKVLDVDGNGAISTDELGEVMRSLGQNPTETGLRDLIKEIDVDLSGTIDFDEFKTLMIAKVGDRESR
    LKLAFSAFDEDNSGQITAVELRTVMSQFGLTDAELKEMLQEVDHDGDGSIDFEEFCQLVLEESESKTGYKDSPISLESSL
    KTVATNNTPVADTTQPTLQEATSNTTPELAQLREQLVQHPNSPNQKRSGTSRLQMQIGLFRLIQGAAYRSFRESFSANHE
    THLRVKNLPYRITDFVEFVKQAIALYKGLGVVEEACYPVLDAVVESIADEYARLQERIKDWKTVAKTPEMLAEEKKILEA
    RSKFANVKEKFAAGVEFAITIKKKSLSLGDIVEGVLAINELNRLRGIEMNEEMAPPPPKSEGNPRDYLFKWNRVILSQAT
    EEVDGAMMPVAYWYEDFMPKLLAAFSVSTAADIQSNTIPDEAALDEWYDLTKKSGEFNRYGADVAENFLNCTAKEKLILK
    QAWRLTHHYLNGVQKRRERLEFGRESGALSQYVSFIDVYLNRTEVKDSQMRVSFPYYIGPAVWRFFHTTAEIVCTKTDIQ
    QKTLMAIFKDFFQLFATMYP
    CPYCRHHLNMYVVQNKEVDMYPVEYLVLGRDPNLRDFEVSLEAKLSTVVDGSSLRLFFWK
    LHNTVSSSIARSEEWYHKDEKAFYTTRFWPSLDSELARANALRYTSIETARIYNIYGMLKPLARLTGVKTELPKLLQKGD
    ENSLKEACIVAQNHIADLEEAVIRGEFLQETYYFDPDVVDKAPLFTPEEEEFARTGMFIEAA

    >gi|186683227|ref|YP_001866423.1| arsenate reductase and related [Nostoc punctiforme PCC 73102]
    MSIQVYGIPNCGTCKKALMWLQSNSIEYEFINTKETPPKSEMIQNWMKSLGSAPMRNTSGQSYRALGDEKKTWTDQQWID
    AFTNDAMLLKRPIFVKDGTAVLVGFRDEAVIKTKLKL

    >gi|186683252|ref|YP_001866448.1| DSBA oxidoreductase [Nostoc punctiforme PCC 73102]
    MITTATGELSLPVSDRDHIRGPKNAPVTLVEYSDYECPYCGRAHFIVKELQQLTGDLMRFVYRHFPLTSVHPHAEQAAEA
    AEAAGAQGKFWEMHNHLLEHQQALDRKHLIEYAANLGLDVPRFSHELAEHAHVARIREDLLSGIQSGVNGTPTFFINGVR
    HDGSYDLRSLLAAIQNAAES

    >gi|186683625|ref|YP_001866821.1| mercuric reductase [Nostoc punctiforme PCC 73102]
    MTNSDLERVTVRPTDEYNQKLVSYVHPPNWVNPQPADVYDLVVIGAGTAGLVVAAGAAGLDLGLKVALIEKHLMGGDCLN
    VGCVPSKTIIRSARVVGEIWDAKDLGVNIPQHNIDVDFPKVMARMRRIRADISPNDSAERFQKLGVDVFLGSGRFASKNT
    VEVGGKTLRFKKAVIATGARAAQLSIPGIEKAGYLTNETVFSLIQRPERLAVIGGGPIGCELAQAFRRLGSEVVLFHSGS
    HLLNKEDAEAAEILQKVLIREGIRVVLNSKLEEVVTVTEGKRLYFSSNSHRDSVTVDEILVGAGRSPNVENLNLEAVGVE
    YDKHQGVKVNDYLQTTNPKIYAAGDICMNWKFTHAADAAARIVIKNTLFSPFGIGRSKLSSLVMPWVTYTDPEIAHVGMY
    EHEAQKLGIEVTTIKIPFSSVDRAIADGEESGFLKIHHKKGSDEIIGATIVSSHAGEMISEVTTAMVNKLGLSKLSSVIH
    PYPTQAEAIKKAADAYRRTLLTSNTKKLLGFLTKLS

    >gi|186683945|ref|YP_001867141.1| redoxin domain-containing protein [Nostoc punctiforme PCC 73102]
    MLPRVRAPELPHNYSWFNTDKPLSLKQLKGRVIILDFWTYCCINCLHILPNLKYLEQKYKDSLTIIGVHSAKFDNEKETE
    NIRQAILRYDVEHPVIIDSNFRLWEEYAVRAWPTLIIIDPEGYVIGQISGEGNRDALDELIQKLIQQHQDKGTINFQELS
    LILEKQRQPLITPLAFPGKVLATQTGLFIADSGHHRLIMSSFDGEILHLIGTGKSGLTDGAFNEAQFFAPQGMAYDAENQ
    ILYVADTENHTLRRVDMKRQVVDAIAGTGEQSRNIHPHGGVGLETPLNSPWDLVKVGNTLFIAMAGPHQIWEMDLETSMI
    KTYAGTGAEACIDGSLTESAFAQPSGISTDGKELYIADSEVSSIRGVGIVEPYQVRTVCGSGGLFGFGDVDGQGEDVRLQ
    HCLGVEFAQNFIWVTDTYNHKIKLVSPSGNCQTIQGDGTAGLQDGQGKNSRFFEPSGLSINGSYLYIADTNNHAIRRVDL
    NTLEVTTLEFFGLCAPDVCIPPNVTATDF

    >gi|186684011|ref|YP_001867207.1| HesB/YadR/YfhF-family protein [Nostoc punctiforme PCC 73102]
    MIHLSQAAASEIGRIKSKQQPNILFRLAVKPGGCSGLFYDMSFDETIKVGDQVFNLDEIQIVIDATSLNYLNGLRVDYSE
    DLMGGGFRFHNPQAIATCGCGNSFLTSNQ

    >gi|186684039|ref|YP_001867235.1| glutaredoxin [Nostoc punctiforme PCC 73102]
    MTPELKEKIDNLLQQNKILVFMKGNKLMPQCGFSNNVVQILNTLGVPFETVDVLSDSEIRQGIKEYSNWPTIPQVYINGE
    FVGGSDILIELYQKGELQQKVEVALAS

    >gi|186684044|ref|YP_001867240.1| glutaredoxin [Nostoc punctiforme PCC 73102]
    MLDFLNPLLNRHPERVKANVELYTWQTCPYCIRAKILLWWKGVNFTEYKIDGDEGARAKMAERANGRRTVPQIFINNQHI
    GGCDDLYQLDTQSQLDPLLAQAAI

    >gi|186684090|ref|YP_001867286.1| thioredoxin domain-containing protein [Nostoc punctiforme PCC 73102]
    MSKAVITITDAEFETEVLKAEQPVLVYFWASWCGPCQLMSPMINSAASKYSDRLKVVKMEIDPNPLTVKQYQVEGVPALR
    LFQGQEVLISTEGVIGKDKLLELLDTHLNSN

    >gi|186684303|ref|YP_001867499.1| dihydrolipoamide dehydrogenase [Nostoc punctiforme PCC 73102]
    MSQGFDYDLVIIGAGVGGHGAALHAVSCGLKTAIIEAGDMGGTCVNRGCIPSKALLAASGRVRELRNAHHLKSLGIQIGS
    VEFDRQAIANHANNLVSKIQGDLTNSLKRLGVDIIRGWGKIAGAQKVAVTGDGAEKIITAKDIILSPGSIPFVPPGIEVD
    GKTVFTSDQGVKLESLPDWVAIIGSGYIGLEFSDVYSALGCEITLIEALDQLMPGFDRDIAKLAERVLITPRDIETKVGI
    YAKKVTPGSPVVIELANFKTKEDVDVIEVDACLVATGRIPATKNLGLESVGIELDRRNFIPVDDRMAVLSAGEVVPNVWA
    IGDANGKMMLAHAASAQGIIAVENIVGRERIVDYRSIPAAAFTHPEVSYVGLTETAAKELGQTEGFEIATSRSYFKGNSK
    ALAENEADGIAKVIYRKDTGEVLGVHIFGLHASDLIHEASAAIANRQSVQSLAHLVHAHPTLSEVLDEAYKRAIAI

    >gi|186684368|ref|YP_001867564.1| methionine sulfoxide reductase A [Nostoc punctiforme PCC 73102]
    MALFGFGKKQVMPTPEEALSGRAQSMSVPAAHYVNKNPLKAPYPDGLEKAIFGLGCFWGAERKFWQLKGVYTTAVGYAAG
    FTPNPTYEEVCSGRTGHNEVVLVVFDPKVISYSELLKVFWESHNPTQGMRQGNDAGTQYRSGIYVYSESQKQLAEASREA
    YQQALNDAGYGKITTEILDAPEFYYAEAYHQQYLAKNPNGYCGLGGTNVSCPVGVVESQVSS

    >gi|186684625|ref|YP_001867821.1| vitamin K epoxide reductase [Nostoc punctiforme PCC 73102]
    MIRRRSTPWIHKWSRPLIAAIAGCGALITGYLTIEKLTGGSAACVAEAGTKGCNDVLSSPWATVLGQPLALFGFLAYISM
    VIFALAPLVFNSGENNSRKQLENWTWWLLLVGAIAMSVFSGYLMYVLASQIKAVCPYCIGSALFSVSLLVLTIMGRTWED
    IGQIFFTALIVGIVTLIGTLGVYAGVNKSDVTSGTPGQPVKITFNPKEDPNPAFGWEVTTTSGEAEMALASHLAKVGAKE
    YTAYW
    CPHCHEQKLLFGKEAEEIINRDVKVECAPDGLKAQPELCKAAKIEGFPTWIINGKSYSGVQNLEELAKVSGYTGP
    IDFKRFK

    >gi|186684761|ref|YP_001867957.1| glutaredoxin family protein [Nostoc punctiforme PCC 73102]
    MVANRRGQRVPNVTFHTRKDNQWVDVTTDQLFANKTVVVFSLPGAYTPTCSSTHLPGYNELAGIFKENGVDDIICISVND
    AFVMNEWSKDQEAENITLIPDGNGEFTEGMGMLVDKSDLGFGKRSWRYSMLVRDGVINQMFIEPDEPGDPFKVSDAETML
    RYINPQAVKPEVVSLFAKVG
    CPFCARAKAMLKEHGINYEEITLGKDITTRSLRAVTGATTVPQVFIDGKLIGGSEALEAY
    FAAK

    >gi|186684764|ref|YP_001867960.1| glutathione peroxidase [Nostoc punctiforme PCC 73102]
    MSNTISDIAVKTINGEDKQLKDYTGKVLLIVNVASYCGYTSQYEGLEKLNQKYREQGLRILGFPCNDFGAQEPGSNEEIV
    QFCTSKYSVTFELFDKIHAKGPQQHPLYERLTKAVEPTGTIAWNFEKFLVNKKGEVTARFNSSVQPNSPELIAIIEKELA
    K

    >gi|186684771|ref|YP_001867967.1| DSBA oxidoreductase [Nostoc punctiforme PCC 73102]
    MSFSMSKLFDSFSPLIQYMRTWAAISLLCLVVAWSFPAQAASRIDPQLEQQVLQIIREHPEAIIESVQAYQQQQQQKLKQ
    AQQAFLQDFKTNPQTVIGESPTTGSTQSKTVLIEFSDFQ
    CPYCAEAHKTLKQLLAKYPDKVKLVYKNLPLISIHAEALPS
    ATAAWAAYQQGKFWEYHDALFTNQKQLGQALYLDIAKKLNLDLGKFKRDLNLATPAITKDVQLAEKLGVSGTPFFIINSP
    TFSGVAQLADIENILTAAK

    >gi|186684848|ref|YP_001868044.1| putative iron transport system substrate-binding protein [Nostoc punctiforme PCC 73102]
    MTVSNVRIVSLIPGGTEILAALGLVNAIVGRSHECDYPPEILDRPVCTQARLDSNASSSQINDEVNDFLQSALSIYEIKT
    DVLEQLQPTHILTQDQCDV
    CAVSLDEVEKAVATLIDSKPQIISLQPNILQDIWADIERVGNAFEVDSVKALENLEARVKI
    CQQRIQGLSLNEQPTVACIEWTDPLMVAANWIPELVNLAGGQSLFCCTGQPSPILPWETLLTTDPDVIVFMPCGFDLNRT
    RQEAKLLTQRPEWEKLHATQAGRVYITDGNSYFNRPGPRLVDSLEILAEILHPEIFQYGYKGTAWELL

    >gi|186684898|ref|YP_001868094.1| glutaredoxin 3 [Nostoc punctiforme PCC 73102]
    MAAKVEIYTWRTCPFCIRAKSLLKNKGVEFIEYSIDGDEAARNKMAQRANGRRSLPQIFINDDHIGGCDDIHALDSQGRL
    DELLTSV

    >gi|186685103|ref|YP_001868299.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Nostoc punctiforme PCC 73102]
    MTIDYDVVIIGGSLAGYYAALAATQLRATVALVEPKVDYGFTHHHALTEIGKLAQKLNDAASFGIHATKTDISEDCHISM
    AWQEAMLYAQ
    CVAANLKEQHSPAILAALGVDVIVGSGQFQSSPQLAFAVNNRLLHARTYLLASGSRPEIPEIEGLQSTGY
    LTLSNIWQSLQGETLPKNWVIIGGIPQSIEIAQTLARFGCSVTLVVKHPYALSHIDHEIAILLQAQLEVEGVRVLTDKQV
    TQVRLIEAKKWIQAGDKAIETDEILVATGQQPNIESLNLAMVGVKWHRRSLVVNDKLQTTNHRIYACGDVIGGYDFANIA
    NYEAKIALNNALFFPRLRVNYRSIPWAMFSVPMVAQVGLTEAQAKRLFSRDEVLVLRQYFKTVAAAQLRDETTGMCKLIV
    LHNGEILGASILGAEAGELINLIALAMSQKIKVKDLANLSPVYPSFSEILEQAAREWSKQKLNSDIAWQEFLEGFFHFRR
    NWNL

    >gi|186685301|ref|YP_001868497.1| methylated-DNA--protein-cysteine methyltransferase [Nostoc punctiforme PCC 73102]
    MQLQQTQLLEETLWKAVLNRDATIDGKFFYGVRSTGIYCRPICPSRRPNRNQVCFFQSAKEAQNAGFRPCKRCQPQFETV
    PNPAKAKILAVCRYIEAQSDRIPTLSELCSQVEMSPSYLQKVFKQIIGVSPFQYADALRSQRLKQRLQSGEEIAHAVYDT
    GYGSSSQIYEKAPKQLGMTPKIYQQAGKTINIVYAIAPCPLGYLLVATTDKGICAVKLGDEADKLEHILNQEFHQAHIIR
    DDHIHKEWIQGILDLIAGDETHLDLPLDIRGTAFQKQVWQVLQKIPYSETRTYTDIARDIAKPQAVRAVGNACGANPIAV
    IIP
    CHRVLRSDGSLGGYRWGIERKQKLLVQESKLSKDDSNT

    >gi|186685342|ref|YP_001868538.1| rhodanese domain-containing protein [Nostoc punctiforme PCC 73102]
    MSQYADPSVLVDTQWLENHLNDPNVRIIEVNMSPEPYKNAHIPGAVFWNIFTDLLLPDLKLNLDAIAFERLMARSGITNN
    TTVIAYGSYPGTGAWIFWLLQVFGHENVKVLNGGYQKWKSEDRPLATELSTFPATDYRARATDPHLRVLHNEVQASIGRS
    DVYDGLRLRVLLDVRTIQEYCGEWFFDQPPKEGQLTGHIPGAVHLEHTLTLNEDGTFKSFDELKNLYTSKGITADKEVFP
    Y
    CTIGARSGYIWFVLKYLLGYPNVRNYDGSWNEWSRLPDVAIEK

    >gi|186685436|ref|YP_001868632.1| thioredoxin [Nostoc punctiforme PCC 73102]
    MSADTQIVAYLEESEFDVVLNGSEEKVVVVDFTATWCGPCRLVSPLMEQLAEEYKGRAKVVKVDVDRNKPIFKKFGLRSI
    PAVLIFKDGILAETIVGVSPYEQFSEAVQKLLEVV

    >gi|186685639|ref|YP_001868835.1| thioredoxin [Nostoc punctiforme PCC 73102]
    MSTAAQVTDSSFKQEVLDSDVPVLVDFWAPWCGPCRMVAPVVDEISEQYKGQIKVVKVNTDENPQVASQYGIRSIPTLMI
    FKDGQKVDMVVGAVPKSTLASTLEKYL

    >gi|186685800|ref|YP_001868996.1| rhodanese domain-containing protein [Nostoc punctiforme PCC 73102]
    MNQISVEELAQRLSSGDGSIQLVDVREPEELAIANIEGFVNLPLSQFAEWGHEIPTLFNPQAETLVLCHHGIRSAQMCQW
    LIAQGFTNVQNISGGIDAYSILVDHSIPQY

    >gi|186685950|ref|YP_001869146.1| glutathione S-transferase domain-containing protein [Nostoc punctiforme PCC 73102]
    MTTAPLSWEELETLTDYQIDTVNGLTNAKARLRLFGQPESDVRVTLYRDNHAWCPYCQKVWLWLEEKQIPYRIEKVTMFC
    YGEKESWYKRKVPSGMLPAIELDGRIIKESDDILIALEKVFAPLNQGMEDRMVLPLRQLERLLFRAWCVWLCSRAGSSQQ
    EQRNREQFIEMVARIEEALGRTPSPYFLDSFGIVDVIFTPYLERMNASLYYYKGYSLREENPRLSAWFAAMESRPTYCGT
    QSDFHTHAHDLPPQMGGCWENGETQMLLNKARVDNGPWFGLPDVAYPEPENSRMEALKRTIEHRINIIRVNPLDDKLFDQ
    ALRCALTHMMTGEDYVPPSGADVALRYLRDRINVPRDMSIYAAKRLRESLEKTAALAGDGQPDPIPTKHRRDQDPSNFVI
    K

    >gi|186686118|ref|YP_001869314.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nostoc punctiforme PCC 73102]
    MSLTYGTEGSLRVGQQAPDFTATAVVDQEFKTIKLSDYRGKYVVLFFYPLDFTFVCPTEITAFSDRYEEFKKINTEVLGA
    SVDSEFSHLAWIQTDRKSGGVGDLNYPLVSDIKKEISAAYNVLDPAAGIALRGLFLIDKDGIIQHATINNLAFGRSVDET
    LRTLQAIQYVQSHPDEVCPAGWQPGDKTMNPDPVKSKVYFSAV

    >gi|186686119|ref|YP_001869315.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nostoc punctiforme PCC 73102]
    MLTSTDFSGLLNERFFRNFLPVPARNQLRLGVGTPDFQLPDITNGTLVKLSDYKGKQPVLLAFTRIFTEKQYCPFCFPHI
    KALNENYEEFKNRGIEVLMITSTDEGQSQIVVKDLGLKMPLLSDPSCRVFRTYQVGQALGAPLPAQFVLDKEGKLSYWHL
    FSFLDRNASIEILLEQFN

    >gi|186686147|ref|YP_001869343.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nostoc punctiforme PCC 73102]
    MNHNLLYRRQLLFYLGLGVVGIGAATTFSNFRKVNAPSISPAKSNNTQDLETTVKTPAGKSLPEFQGISQWLNSSPLAIA
    DLKGSVILIQFWTFA
    CINCQRTLPYITKWHQQYESQGLKVIGIHTPEFAFERDPNNIKKALQQHKITYPVPVDNEYKTWN
    AYENQYWPHIFLADRQGLLQYDHIGEGAYEKIEQTIRQLLG

    >gi|186686170|ref|YP_001869366.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nostoc punctiforme PCC 73102]
    MNILETIDTPIGSYAPDFELPGIDGQVHHLRRYLEKFRAVGVISMCNHCPYVEWYIDRLKKIQAKFAPKGFTLIGMNGSD
    GNHETRTSFENMKAFAERHNLNFPYLWDSTQDVTQSFGATKTPMAFLIDANGIVRYKGKIDNHPQDASAVGEEYLRTAIA
    SLFLGQPIDVPQTEPVGTTLIWRN

    >gi|186686219|ref|YP_001869415.1| thioredoxin domain-containing protein [Nostoc punctiforme PCC 73102]
    MVLSVSERTFTQEVLESPIPVLVNFEAPWCGLCRIIHPLLLQFQAQCGDEIKLVGVNADQNFKLSTTYRLKSLPTLLLIQ
    NGTVRHRLEGFRGREDLRLALEDIKASYSNYAKIYNTPKTVDLECRSA

    >gi|186686249|ref|YP_001869445.1| hypothetical protein Npun_R6218 [Nostoc punctiforme PCC 73102]
    MTNRLAEAKSLYLRKHAENPIDWWPWCDEALATARAQNKPIFLSIGYSSCHWCTVMEGEAFSDSAIADYMNANYLPIKVD
    REERPDLDSIYMQALQMMSGQGGWPLNIFLSPEDLVPFYAGTYFPVDPRYGRPGFLQVLQALRRYYDTEKAELQQRKALI
    IESLLTSAVLQDGTTDELEDRELLRQGWETSTGVITPGQSGNSFPMIPYTELALRGTRFNFESRYDGKQVCTQRGLDLAL
    GGIYDHVGGGFHRYTVDPTWTVPHFEKMLYDNGQIVEYIANLWSAGVQEPAFERAVAVTVQWLKREMTAPEGYFYASQDA
    DSFTEPTAVEPEEGAFYVWSYSEVQQLLTPEELTELQQQFTVTPNGNFEGRNVLQRRNSGKLSATLETSLSKLFTARYGV
    SSELLETFPPACNNQEAKTTNWPGRIPSVTDTKMIVAWNSLMISGLAKAAGVFQQPLYLELAARAANFILENQFVDGRFQ
    RLNYQGEPTVLAQSEDYAFFVKALLDLQASNPEHKQWLENAIAIQDEFTEFLWSVELGGYFNTSSDSSQDLIVRERSYAD
    NATPSANGIAIANLVRLALLTDNLDYLDLAELGLKAFKSVMHRAPQACPSLFTALDWYRNSTLIRSTTEQINSLIPKFLP
    TAVFAVTSDLPEGSVGLVCQGLKCLAPAESVEHLLQQVEKSQNRG

    >gi|186686280|ref|YP_001869476.1| thioredoxin [Nostoc punctiforme PCC 73102]
    MSSITNVTEATFKQEVLESEIPVLVDFWAPWCGPCRMVGPVVDEVAAEYEGQVKFVKLNTDQNPTVASHYGIRSIPTLMV
    FKGGRQVDTVVGAVPKTTLNKTLAQHL

    >gi|186686487|ref|YP_001869683.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nostoc punctiforme PCC 73102]
    MTNIPQIGQPAPDFSTPDQNGNSVTLDDFSSQWVILYFYPKDDTPGCTTEAKDFTELYQDFSALGAKILGVSPDLGKSHC
    KFISKHNLSITLLSDPEHILTEAYGAWRLKKFMGKEYMGVARSTFLISPDKIIAYTWPNVKAKGHAQAVLTKLQELAAT

    >gi|186686508|ref|YP_001869704.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nostoc punctiforme PCC 73102]
    MALRLGDTVPNFTQASTHGDIDFYQWAGDSWVVLFSHPADFTPVCTTELGTVAKLKPEFDKRNVKAIALSVDDVESHKGW
    VGDIEETQSTTLNYPILADADRKVADLYDMIHPNANAAVTVRSVFVIDPNKKLRLSFTYPPSTGRNFDELLRVIDSLQLT
    DNYSVATPADWKDGEDVVIVPSLKDPEVLKEKFPKGYEEIKPYLRMTPQPNK

    >gi|186686564|ref|YP_001869760.1| alkylhydroperoxidase [Nostoc punctiforme PCC 73102]
    MTKLIEYEEASDEIRAVYDDIRVTRQNDYINNFWKAIANHPPTLQRTWQAVKEVMTSPGEIDPLMRELIYIAVSATNGCE
    Y
    CIASHTAGARAKGMNDTMFGELMAIAATANMTNRLANGYQIPVDERFKT

    >gi|186687197|ref|YP_001870340.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Nostoc punctiforme PCC 73102]
    METADVIVIGSGQGGIPLAADFASSGRNVVLFERDALGGSCINYGCTPSKAFLASAHAAGRARQATKLGIHAQVEVDFSA
    VMERVRSIRSQFNQGVKRRLDSAGVRVVCAEAAFTGERTVSGGGVTVQAPLIVINTGTSSTIPDFSGLVGTPYLTNRNFF
    DLQQIPPRLLVVGGGYIALELGQGMARLGSQTELIVRGERLLAQEESDVSAVLADAFEQDGIGLHFNVTVQQVAYTNRVF
    TLTLNNGEVLDGEALLIATGRKPNTQALNSAVTGVELDAQGFIKIDEQFQTTCAGIYAIGDAAKQPAFTHVSWEDYRRLK
    AILCGEHRTRNDRVLGYAVYTEPQVGRVGMTLEQAHKQGITASEVTLPMAHIARSIEWGHDLGFYRMVIDTQTNLILGAT
    LVGYETAELVHVFLSLMEAKATWQVLEQSVHIHPTYGEALPSLARLLVGDDMPTCPNM