Nocardiopsis dassonvillei DSM 43111 uid49483

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|297559040|ref|YP_003678014.1| methylated-DNA/protein-cysteinemethyltransferase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MATVEFRAPLPGPTRYTTMESPVGDLTLFGDGAALGGVLTPAKDGLTRVVPQDWVADHKPFADAEEQLRAYFAGELREFT
    LPLAPVGTDWQLRVWAALTTIPFGETASYGQLAEELGRPTASRAVGMANGRNPISIIVP
    CHRVIGANGSLTGYAGGLERK
    EFLLGLEGRVAGIR

    >gi|297559081|ref|YP_003678055.1| protein of unknown function DUF255 [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MSNRLSDATSPYLLQHADNPVEWWPWGEEALAEARRRDVPLLVSVGYAACHWCHVMAHESFEDEATAALMNSLFVNVKVD
    REERPDVDAVYMEATQAMTGQGGWPMTVFATPDGAPFYCGTYFPREHFQRLLRGVADAWRDQRTELVGQGARVVEALSGP
    RTLAAAPPPSADRLDLAVRALVRDYDSAHGGFGTAPKFPPSMLLSFLTAQDERTRPLQSADESTPAWLMASGTALAMAQG
    GMYDQLGGGFARYSVDREWTVPHFEKMLYDNALLLRAYARMGRRPSGPGVSDAATHALLRRVAGETADWMLRDLRTPEGG
    FASALDADSEGEEGTYYVWTPAQLREVLGEEDAAFAAEVFGVTEEGTFERGASVLQLPAPPADAWRYQRVREALLAARAE
    RVAPARDDKVVAAWNGLAVAALAEAGVLLERPDLVEAARAAADLLLRVHLRDGRLVRTSRDGRAGTSAGVLEDYADVAEG
    LLVLHGVTGEARYAHEAGRLLDTVLERFGDGSGGFYDTADDAERLFNRPQDPTDNVTPSGRSAAASALLSYAALTGSERH
    RTAAEEALSPVAVLAEKAARFAGWGLATGEALLTGPRAVAVVGDPDDPRTAELVHAALVWAPLGTVLSRGDGRDDGGVPL
    LRDRAPVGGRPTAYVCEGFVCKLPVTSPEDLREQLLA

    >gi|297559100|ref|YP_003678074.1| thioredoxin [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MPSTNSTAEVSAVTDATFERDVLDVEGPVLVEFWADWCPPCRMLAPVLDRIADERAGTLAVRKVDADDNPLTTRGHGVLS
    LPTLMLFRDGEPLLKLVGARSRARLLSEVDTALRG

    >gi|297559387|ref|YP_003678361.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MSDPIRLEPGDQAPDFTLDDADGKPVTLSEVLASTGKRVVLYFYPAAMTPGCTTQACDFRDNLRDFDSAGLTVLGVSPDT
    SDKLARFRDKEGLTFPLLGDPGKDTLRAYGAFGEKKNYGRVVQGVIRSTVVVGTDGRVEKAFYNVKATGHVDRIKRELGL


    >gi|297559920|ref|YP_003678894.1| dihydrolipoamide dehydrogenase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MSESGGTFDLVVLGGGSGGYAAALRAAELDMSVVLIEKDKLGGTCLHRGCIPTKALLHSAEVADSAKESENFGVKATFEG
    IDIQAVHTYKDKVIGGLFKGLTGLVKSRKITVVEGEGKLTGKDEVTVDGAVYKGRNILLATGSKPKTLGLDIDGEKVMTS
    DQALDLDRVPESVIVLGGGVIGVEFASVWRSYGADVTIVEALPHLVPVEEESSSKLLERAFRKRKIKYELGTPFESVKTT
    DSGVTVTLKGGKTLEAEVLLVAIGRGPVSEGLGYEEQGITLDRGFVQVDENLHTGVGNVYAVGDLIPTLQLAHVGFAEGI
    FVAEHIAGQNPPAIDYDGVPRVTYCEPEVASVGLTTKVAKERGHDVVEMNYSLAGNGKSQILQTQGAVKVIAEKDGPVLG
    VHMVGSRVGELIAEGQLIYNWEALPSEVAQLIHPHPSQSEALGEAHLALAGKPLHVHD

    >gi|297560101|ref|YP_003679075.1| alkylhydroperoxidase like protein, AhpD family [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MARERVIWAKKLPEVYGKLDEIDKVISGHLDGALLELVKLRASVLNGCSFCIDLHTQRALEAGESQQRLFLVSAWYEAGE
    IFTDAERSALALTDEITRLGEHGVSDEVYEGAAEHFEDQELAALIAGIAMMNLYNRLAVTSHLHPRKR

    >gi|297560312|ref|YP_003679286.1| DSBA oxidoreductase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MSSSSGSGPGRGKKQVNARPSPGAERGRGRTPDGGGGSWRGLLFAGLALLVVAGLLVANRAVDDRAQEPAAREPAADSAP
    HSAGADDQTPDQREFGALLARRDPEDPAAMGEVDAPVVMVAYSDYN
    CPYCGRWARETQPELMHYVERGDLRIEWRDFPII
    TGSSETVSHAARAAGMQGGFWEFHEAYFTHGEKFEGEALEEVLDGIVAELGMDPERFEEDRHGDEVASMVSRDFAEAQGI
    GVTSTPAFLVNGQPLMGAQPLSVFVSAIEDALADAGRDGDG

    >gi|297560316|ref|YP_003679290.1| DSBA oxidoreductase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MSEPSRRNRAPALLLAGSACALLLLTALFVNAEDSGAAGSPGGTAADTVSEETRAAGEELARRDPADPHAMGTADAPVVL
    IVYSDYL
    CPFCADWVHRTQPELVEAYVAPGLVRIEWREFPYLGEGSRLLARGAVAAGNQDRFWEYHARVYAAPEDFTGDA
    DEVRASMRDAAEEIGLDTDAFARDLDAAEAGAAVERDFTEGQDMGMSGAPAFLVNGDPVLGAQPLEAFTDSIDAALRAAG
    R

    >gi|297560526|ref|YP_003679500.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MNDQLENGYDAVVVGGGAAGLNGALMLARARRSVAVLDSGAPRNAPASGVHGLLAREGMSPAELLERGRAEVRGYGGHVN
    TGEVTAVTRDGGGFRVELADGRGVHARRVLVTTGLVDELPDVAGVREQWGAGVVH
    CPYCHGWEARDRAIGVLASGPMAVH
    QALLFRQWSEDVTLFTHTTPSPGEEDAEKLAARGIRVVEGPVASLETADGRITGLRLADGTVVDREVVAVGTRMVARASF
    LETLGLRAREHPMGVGEYVPTDENGRTEVPGVWAAGNVTDLTAQVGASAASGAAAGAQINADLVNEDTRRAVAARRDAFS
    AESEARVGELVAGEGRHGL

    >gi|297560597|ref|YP_003679571.1| protein of unknown function DUF395 YeeE/YedE [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MTTHPSAPPGATEPAPAGTAPDAAAPVSPALSLSWRPTLSVPQPRAAEAEPVRWWPLGIALAVAVGLAAYVWNTHGALPA
    VLLLLGTGLGFTLFHSRFGFTSAWRQFLAVGNGTGLRAHAVLLGTTATLFALVIGTGTGLFGNDPQASAGPIGIALFLGA
    FLFGIGMQLGGA
    CASGTLFAVGSGQSAIVITLVGFIAGSVIYSAAWPLVNDLPALPPFLLSDHVGWGGSWAITIAVLAAV
    VVGTRVVQNRRVPPPVGTPPSARGLLRVVRGSWPMIAGALVLSVLGAAVLLVSGGAWGVTSAFNLWGAKALQLLGAHPET
    WAFWNQPQQAAQLAGPVLQDKTSLTNIGIILGAAVAAAAAGAWKLHTGLSWKLVAAGLLGGILMGIGARLAGGCNIGAYL
    AGIGSGSLHGWLWAVFALAGTWAGLRARSLFGLGVPKPGDSVC

    >gi|297560667|ref|YP_003679641.1| Rhodanese domain protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MSDHGIDVRAVRVLLETDPRALIVDVRTPAEYEGSHIPGAVNLPLEQVDAHLERIVAGAGGRLVLVCRSGKRAGRCRNTL
    AGAGLGDTVVLEGGMNAWEAQGAPLERGRERWALERQVRLVAGGIVLGSVLASPVWFPAVAVAGVVGAGLVFAAVTDTCA
    MGMALSRLPYNRPSGEVDIEDSLARIAAGR

    >gi|297560668|ref|YP_003679642.1| Rhodanese domain protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MLLERLYDDDLAQAGYFVGCQASGEAVVVDARRDIDDYLGLARAHGMRIVAVTETHIHADYLSGTRELAAATGATAYVSG
    EGGQDWQYGFDAERLLDGDAITVGNITVRASHTPGHTPEHLSFLVTDGAFSRDPGYLLSGDFVFAGDLGRPDLLDEAAGG
    SGTRFEGARQLFESLRRVFLNLPDHVQVLPGHGAGSACGKALGALPATTVGYERLNAWWGPYLRAGDMEGFVAELLDGQP
    DAHAYFARMKRQNREGPRVLGRLAPPPALSDEEVGRSLNEGGSVLVDTRPHVEVHRGTVAGALNIPGPDKAATFGAWAHD
    PESETRPLVLLADDGDTARRVRDHLLRVGIDHVSGYTTSTEGLPRTVPPRVTPEELEQAGAALLLDVRTRGEHAEGHIPG
    SRQLSAGRVLWNLDALPTDGTIVSY
    CQSGARSSVAASALRRAGYDVVELDRGYGAWEDWRRDRDAPVRAGAD

    >gi|297560677|ref|YP_003679651.1| DSBA oxidoreductase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MSKNLGITLGLIMVAVIGLGLLVALDDRGGAPAAPDGSADPQAAPTAPAGLLVREDSRHLDRVEEAPVTVVEFLDFECEA
    CRAQFPVMERIREDYDGRINTVIRYFPMPGHTNAEPAAAAVEAAAQQGALEQMYVRMYETQAEWGESQDSKAEVFVGFAE
    DLGLDTEEFVRAVEDPATLERVRSDFRDGVALGVRGTPTIFVNGRPTPSMPGYETLSAMIDRELEG

    >gi|297560761|ref|YP_003679735.1| hypothetical protein Ndas_1801 [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MTHEPWTVDFWFDPSCPLSWVTARWLRGVARERPVTVRWRVMSLSVLNEGRDEDPEGDTEGYLWIPARVCAAVQSGHGHE
    ALGRFHEALWTGEDAAESGWIGDLADALRRAGLPGDLAGAGLSGEHDPFLRASHHDAVRRVPGEVGTPILALAGADGAPR
    AVFGPVVTEPPGREESLRLWEAVVLLTGVPGFREIKA

    >gi|297560815|ref|YP_003679789.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MQHMDAIVIGMGPGGETVASRLLAAGKRVAVVERELIGGECGYWACIPTKVLLRPPEVRQEADGAAGVSRPDLRWPELRD
    YRDQMIRHLDDSAQVQGYRDQGALVLRGEGRVIGRDPWRVAVGDTELTADHVVVATGSEAVRPPIEGLDDLDPSVVWTNR
    EATTLTDVPGRAVVVGGSAVGVELGQFLARMGSQVTLVQRGPRLVNREEPRLCELISDQFDRDGVTVHLNTQVSAVARDG
    DGIRATLDNGEHVEADVIVLATGRRPRGGGLGLEEVGVELDRASLRVDERCRAAPGLWGVGDATGRALFTHVAKYQGRVV
    ADNILGKDRAADYTGVPRVIFSYPEIAGVGLTEAQAREQGIDTATAEADLPQTLARPWTYDTDPRGTLGLVADRRRGVLV
    GAWAFSPMASEWIHTAALAIRTGLPVAALLDSIPQFPTYNEAYLIALENLEM

    >gi|297560896|ref|YP_003679870.1| peroxiredoxin, Ohr subfamily [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MAYDVMYTANATVTGEGRKGTGRTDDRRLEVDLSVPKGMGGDDGPGTNPEQLFAVGYGACFHGALKAVARKEKVDVDGST
    IDAQVSLGKADDGMALAVALTVTIPGVDQAKAEELVEGAHQM
    CPYSRATRGNIEVTLTAKTA

    >gi|297561128|ref|YP_003680102.1| DSBA oxidoreductase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MWSDVVCPWCYIGKRRLERALELFEHADRVRVRWRSFQLDPSFPPGVSEPVYDSLSRKMGAPREQVRSMTEQVTRVAAQE
    GLDYDFAGGFMVNTFDVHRLIHLARTRGLEGRAQERFMRAQLVEARDLSDADVLVEVAAEAGLEPQEARRVLEGEEHAED
    VREDIALARRLGATGVPFFVMDRAVGISGAQSVEVVLSALDKAHRTGRG

    >gi|297561614|ref|YP_003680588.1| glutaredoxin [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MNEAAIRVYGADWCRDCRRTKKQLTELAVPFEYVDVEHDPAATERAREISGRTNIPVVVYPDGSHHVEPDDARVEAKLRE
    LSLI

    >gi|297561657|ref|YP_003680631.1| hypothetical protein Ndas_2711 [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MLGVMEVKEPRLEIEYCTRCRWLPRATWMAQELLTTFEAELGEVALVPGTNGVFEVRLDGESVWSRRTDAAFTDAAELKR
    LIRDRIAPEHHLGHSELPSDG

    >gi|297561768|ref|YP_003680742.1| methionine-R-sulfoxide reductase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MADSADQAQDNGSGPKDIPRTDQEWRERLNSQEYAVLREAATERPWTGEYVDTTTAGVYRCRGCGAELFRSGEKFESHCG
    WPSFYDPADSDAVVLHEDRSLGMVRTEVRCATCDSHLGHVFHGEGYATPTDDRY
    CINSVALTLEPTE

    >gi|297561885|ref|YP_003680859.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MTAPVGAPAPDFTLQDQYGQDTSPVSGRPVLLVFYPLAFSGVCSGELAELSARHPEFADLGAEVMAVSVDSVFALRTWSD
    REGFPFPLLSDFWPHGGVARAYGVFDPERGTARRGTFLIDAGGVVRWSIVTGFSEPRDVDEYLRQLRELV

    >gi|297562095|ref|YP_003681069.1| iron-sulfur cluster assembly accessory protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MTVQSETTEGIILTDEASSKVRALLEQEGRDDLRLRVAVQPGGCSGLRYQLYFDERELDGDVVSDFGGVEVVTDRMSSPY
    LIGATIDFVDTIEKQGFTIDNPNATGSCACGDSFN

    >gi|297562349|ref|YP_003681323.1| hypothetical protein Ndas_3412 [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MTQTFDPGDGQETVHADMWFDPACPWAWITSRWLVEVERVRPVRVRWHVMSLGVLNEGRDLPEDYRASIDGSWEAVRVCV
    AAEQRFGPEVLGGLYTALGTRFHNGGEPRTTDTIRAALAEAGLPEDLAEAGASTDYDQALRASHAEAMKLVGEDVGTPVV
    QVADTAFFGPVVTPIPRGEAAGRLWDGVLLVAGTDGFFELKRTRTRDPVFD

    >gi|297562737|ref|YP_003681711.1| glutaredoxin-like protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MTSAATEQFTMYTTPWCGYCKRLKSQLAREGITGREVNIEEHPEAAELVMRANNGNQTVPTLVFSDGAAMTNPSLAQVKQ
    KLAELS

    >gi|297562754|ref|YP_003681728.1| UBA/THIF-type NAD/FAD binding protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MSLPPLVEPADELTVDEVRRYSRHLIIPDVGMDGQKRLKNAKVLVVGAGGLGSPALLYLAAAGVGTLGIIDFDVVDESNL
    QRQVIHGQSDVGRPKAESARDSIKEINPGVRVILHQERLDSDNALEIFADYDLVLDGTDNFATRYLVNDACVILDKPYVW
    GSIYRFDGQVSVFWNEYGPQYRDLYPEPPPPGMVPS
    CAEGGVLGVLCASIGSVMVNEAIKLITGIGEPLVGRLLIFDALE
    MTWREVKVRKDPDTEPVTELIDYEAFCGAVSEEATEAAAGSTITAGELKDLLDNKPEEIFLVDVREKNEYEIVSIPGATL
    IPKGEFLNGKALERLPQDRRIVLH
    CKSGVRSAEALAAVHAAGFSDAVHVGGGVLAWINQVDPSLPEY

    >gi|297562879|ref|YP_003681853.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MPAYHPDRGRAWRPGSRGSEASVTKVVIIGGGPGGYEAALVAAQLGADVTVVERDGIGGACVLTDCVPSKSLIATSTRTT
    YVRESDSLGIRIRDAQDEDAVRVDTDRINTRIKLLAQAQSEDTRARLVKEGVEVINGEARLVDPHIVAVGDQRLRADVVL
    IATGAHPRELPSAKPDGERILTWRHLYDMEELPERLIVVGSGVTGAEFASAYQSLGSQVTLVSSRDRVMPTQDPDAAEVL
    EQVFMRRGMTVLNKTRAESVVRTDDGVLVTLSDGRTVEGSHCLMTVGMIPNTQDLGLEEAGVRLGDGGFVEVDRVSRTTV
    PGVYAAGDCTGVNMLASVAAMQGRIAMWHALGEAVSPLKLSTVASTVFTHPELAAVGASEDDVRSGRIDGRSVTLPLNTN
    PRAKMNEVKDGFVKLICRQHTGIVLGGVIVGPRASELILGVSIAVQQRLTVDDIAHTFSVYPSLSGSVTEAARSLMLASP
    E

    >gi|297562911|ref|YP_003681885.1| DSBA oxidoreductase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MRIEIWADTVCPWTYIGKRRLERALAGLDGALREKAEVVWRPYRIDPAAPAEAEPLGPLLRDPRVDTALRACAPGLTPDQ
    NRVRVAEAAAAEGLGPRWGAVWRVSSHDSHRLLALALETGGPGLQGAVAEGVLRAHFTEAGDIGSAGTLDRVAREAGFPD
    GGRLLAAGAGEEEVRELLLRGRAAGVRTSPTLVVNGSALEGARHPDAVRDFLVAAAGRTPRRLPEEVERFRQAESLLDRG
    DPLGALALLRPMLGEHAADRNVCLLAARAYYRSAQLGRARRTLEEMVERSPDDAYARLLLGRTLQRQGELELAGPHLRLA
    GAMAPEYV

    >gi|297562924|ref|YP_003681898.1| Peroxiredoxin [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MSDLDEIPVTLIDGRETTFGEWSGKVRLVVNVASRCGYTPQYERLEKLQHRYGDRGFTVLGVPSNQFLQEFGSEEKIAEY
    CSATWGVTFPMTAKAKLNGKQQHPLYAALSSAEDEDGKAGKVKWNFEKFLVLPDGAVHRFRSSTEPDDPGITALIEKALP
    GDAG

    >gi|297563260|ref|YP_003682234.1| hypothetical protein Ndas_4339 [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MSRSLVIKVTAGEDDPERCNQAFTVAAAALASGVGVSLWLTGESAWFAVPGRAERFSLPHAAPLKDLLDAVLAAGRVTVC
    TQCAARRDLTVDDLIRGVRIAGAPSFVEEAVQDGAQALVY

    >gi|297563272|ref|YP_003682246.1| thiosulfate sulfurtransferase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MSRSDVLVDADWVEAHLDDADVVLVEVDEDTSAYDKGHIPGAVKIDWKTDLQDPVRRDFVDRTGFEKLLSAKGIGNDDQV
    ILYGGNNNWFAAYAYWYFKLYGHTNVRLLDGGRKKWELDSRELVKEVPERAATQYTAQEQDASIRAFRDEVVQAIGTKDL
    VDVRSPDEFTGKLLAPAHLPQETSQRPGHIPTARNIPWAKTANEDGTFKTADELRELYTGAGVDLDKDIIAY
    CRIGERSS
    HTWFALHEILGLENVKNYDGSWTEYGSLVGVPVELGEAEAK

    >gi|297563273|ref|YP_003682247.1| Thioredoxin domain protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MARQDADAAGDVLTAEEVGAPLGERATLVQFSTAFCQPCRATRRVLDEVAGMVGGVAHVEVDAESRLDLVRRLDVTGTPT
    VLVLDASGRVVRRAAGQPRKADVIAAIGAAVL

    >gi|297563342|ref|YP_003682316.1| copper-translocating P-type ATPase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MSSSAAAAGRADTAPVELDIGGMTCAACANRVEKRLNKLDGVTATVNFATERARVSFDGTPTPVEDLVAQVEKAGYTATV
    PRAEPETAEDAAEPADPTRALRDRVIVSAVLSVPVIAMAMIPALQFTHWQWASLTLAAPVVVWGALPFHVAAWKNLRLGS
    ATMDTLVSLGVSAAFLWSLYALFLGTAGMPGMTHPFEFTVARGDGSGNIYLEVAAGVTTFILLGKYFEARSKRRAGAALR
    ALLELGVREATVLRGADSRQESVPVDRLVVGDRFLVRPGEKVATDGVVEEGTSAVDMSMLTGESVPVEVAPGDSVVGATV
    NAGGRLVVRATRVGSDTQLAQMARLVEEAQNGKAEVQRLADRVSGVFVPIAILVALATLVVWLVLGASAPTAFTAAVAVL
    IIACPCALGLATPMALMVGTGRGAQLGILIKGPEVLEDTRRVDTVVLDKTGTVTTGRMTLTGVFTAEGEDEDEVLRLAGA
    LENASEHPIARAVAAGAADRVGALPSPGDFANAEGLGVRGTVGGRAVAVGRVALLEEDGAVLPERLAAALADAEAEGRTA
    VAVGWEGRVRGVLVVADTVKPTSAEAVRRFRELGLTPILLTGDNRAVARAVADQVGIDEVVAEVLPRDKVEVVQRLQGEG
    RTVAMVGDGVNDAAALAQADLGLAMGTGTDVAIEASDLTLVRGDLRAAADAIRLSRRTLSTIKGNLFWAFAYNAAAIPLA
    AAGLLNPMIAGAAMAFSSVFVVSNSQRLRRFRPLARDGAADS

    >gi|297563343|ref|YP_003682317.1| Heavy metal transport/detoxification protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MAATSTAVYTVDGMSCGHCVNSVTEEVSGVAGVTDVKVDLDSKKVTVTSDGPVDDASVRAAIDEAGYEVRG

    >gi|297563774|ref|YP_003682748.1| thioredoxin reductase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MSDVRNVIIIGSGPAGYTAAVYAARAELRPLVFEGSITAGGALMNTTEVENFPGFPDGVMGPDLMDHMRKQAERFGAELV
    PEDVTEVDLTKPVKEVVAGGETFLAHTVILATGSGYRELGVPGEKELSGRGTSW
    CATCDGFFFRDQDIAVVGGGDTAMEE
    ALFLTRFARSVTVIHRRDQLRASRIMAERAHANDKITFLWNSAVTEVLGEERVSGLKVLDTQTGETSTLDVTGLFVAIGH
    DPRVDLFDKQIELDEEGYVKVDFPSTRTNLEGVFAAGDVVDHQYRQAITAAGTGCSAALDAERYLAARGN

    >gi|297563775|ref|YP_003682749.1| thioredoxin [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MSAVKHVTDATFKEEVLSSDKPVLVDFWADWCGPCKQMAPVLDKLADEYGDKIEVVKLNTDQNPETPRSYNVLSLPTMNL
    YKDGEVVKQIIGAKPKRVLEKELAEFL

    >gi|297563922|ref|YP_003682895.1| Redoxin domain protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MPSTSTGTRRSRAVPRLAAAGLAAVLALTGCAGGNEIQASDEENRFISGDGSATTFEAAERTEAPEVTGTTLDGEEVSLG
    DYEGGIVVLNVWASW
    CGPCRAEQPVLDEVHAEYADLGVDFLGVNIKDDETAARSYQESMGVPYPSLYDQPGAVPQAFRDT
    VPPRSIPSTLVIDPEGRIAARVIGPTTYGQLTELLNPLVVEFDFGDPEERPRVAEQEAGQTASPEEADPSAGPSDAPSEA
    DQGSGDEG

    >gi|297563985|ref|YP_003682958.1| peptide methionine sulfoxide reductase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MFGRKTTMVDPARALPGRDTPMDVPFGHTVLGTSLTPPYPEGSRIADVAMGCFWGAERVFWRLGPERGIITTAVGYAGGY
    TPNPTYEEVCSGLTGHTEAVRVVFDPERISYAEILKVFWEGHDPTQGMRQGNDVGTQYRSAILYHDDVQRIAAEASRDAF
    QPVLTRAGYGPITTEIAPLREFYFAEDYHQQYLSDAKNPNGYCGIGGTGASCPIGVAPAE

    >gi|297564092|ref|YP_003683065.1| Rhodanese domain protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MSELLTLPVAVSADWLREHRDRVVLVDSRWYLDGRSGRDAHRAGHLPGAVFTDLDTDLAAPASPEGGRHPLPSAADFAAA
    LGRLGIGDDSSVVVYDDAGGSVAARLVWMLRVLGTPAAFLDGGLQAWAGELEEGDVTPRPVHRTPLPWPADRVVHTDTVR
    AEAGDPAHLLVDARARERYTGERPAPVDARPGHVPGARSAEWTANLGDDGLLAAPGILRERFAALGADSADTITAY
    CGSG
    VTACHDLLALEHAGYSGARLYPGSWSRWGGDDTLPVETGDPRA

    >gi|297564177|ref|YP_003683150.1| Rhodanese domain protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MFGSGVPEANATEVPEGAYLLDVREDDEWNAGHAPDATHIPLGQLNQRAGEIPRDQRVYVVCRVGGRSAQAVAAMNQAGW
    DAVNVSGGMQAWQHAGRDMAAEGGVEPRVI

    >gi|297564280|ref|YP_003683253.1| dihydrolipoamide dehydrogenase [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MGQRHFDLVVLGAGPGGYVTAIRAAQLGLKTAVIEEKYWGGVCLNVGCIPSKALLRNAELAHLFQNEADFFGIKVDGKVE
    FDFGKAHSRSREVADGRVKGVHYLMKKNKITELNGRGTFTDDHTVEVSGEDGATETVTFDHAVIAAGSSTKLLPGTELSE
    RVVTYEEQILTDTLPESIVIAGAGAIGVEFAYVLANYGVDVTIVEFLDRLVPTEDEEVSKELGRAYKKLGVKVMTSTRVE
    SVEDTGEGVRVTVSGGGKEQTLEADKLLQAIGFAPNVEGYGLEKTGVELTDRGAIGIDSRGRTNVPHIFAIGDVTAKLML
    AHTAEAMGIVAAETIAGAETQEIDYRFIPRATYCQPQIASFGYSEKEAREAGFDVQVAKFPFMANGKAHGLGDTRGFVKI
    LSDGKYGEFLGAHMIGPDVTELLPELTLAQQWDLTVHEVARNIHAHPTLSEAVKEAVHGLAGHMINM

    >gi|297564304|ref|YP_003683277.1| thioredoxin [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MPTVELTKDNFAETLKDNDFVLIDFWADWCGPCRQFAPVFETSSEKHTDIVHAKVDTEAQRELAFEFKIQSIPTLMIVRE
    RTVIYNEPGALPSEALESLITQAKELDMDEVREKIAEQGGSPE

    >gi|297560035|ref|YP_003679009.1| fumarate reductase/succinate dehydrogenase flavoprotein domain protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111]
    MSENELVPASGEAWDVVVVGGGAAGLSAALTLARVRRSVLVVDAGEPRNAPAAGAHGLLSRDGIPPLELLRLGREEVASY
    GGRIVSGRVAGVRREDGNLVVSTEDGGRAAARRLLLTTGLVDELPDVPGLARLWGRDVVH
    CVYCHGWEVRDTAVGVLGTG
    PGSFHQALMFRQLSSRVTLFLHNGVDLGDEQWEQLAALGVGVVEGGVRGLEVDDRDRLAGVRLASGKEIAVDTLAVAPRF
    TARADFLSDLGLALTEHPTGMGAQLAVEAGGFTGVEGVWAAGNVADVTANVPVAAASGTQAGAALNADLIAADAGAAAAA
    RAALGTTEARGRVAD