Nocardia farcinica IFM 10152 uid58203

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|54022087|ref|YP_116329.1| hypothetical protein nfa1230 [Nocardia farcinica IFM 10152]
    MTSSEIPSVQVDEVPGAFDTGRPEGAILLDVREDDEWQQGHAPGAVHIPMADVPARTDELDYDAEVYVICRQGGRSIEVV
    KYLTHIGYEAVHVSGGMVAWQRTGRPLVAEGDRQAKIY

    >gi|54022124|ref|YP_116366.1| putative cation transporter [Nocardia farcinica IFM 10152]
    MTTALNQPVAGRIELEIGGMTCASCANRIEKKLNKLDGVTATVNYATEKARVDFTGDIAPEDLIATVEAAGYTAALPAPA
    TTGEPESARVEADPTAALRTRLLVSAVLTVPVIAMAMVPALQFTNWQWLSLTLAAPVVVWGALPFHRAAWTNLRHGTATM
    DTLVSMGTLAALGWSLYALFWGTAGTPGMTHPFELTIARTDGTGNIYLEAAAGVTTFILAGRYFEACSKRRAGAALRALL
    ELGAKEVSVLRGGVEQRIPVEQLAVGDRFVVRPGEKIATDGVVVEGSSAVDASMLTGESVPVEVGESDAVVGATVNVGGR
    LVVRATRIGSDTQLAQIARLVEEAQTGKAQAQRLADRISGIFVPIVIALAVATLGFWLGTGGSVAAAFTAAVAVLIIACP
    CALGLATPTALMVGTGRGAQLGVLIKGPEILESTRRVDTILLDKTGTVTTGTMTLLDVHAAEGEDADRVLAVAGALEHSS
    EHPIARAIAEAARARGELAPVRDFANLAGLGVQGTVDGHEVLVGRPRLLAERGHPMPSGLAEAVDAAEQRGGTAVAVGWD
    GAVRGVLVVADAVKPTSAQAISQFKALGLTPVMVTGDNAAAARTVADQVGIDEVIAEVMPEEKVAAVRRLQEQGRVVAMV
    GDGVNDAAALAQADLGLAMGTGTDVAIEASDLTLVRGDLRAAVDAIRLSRRTLGTIKANLFWAFAYNVAAIPLAMAGLLN
    PMLAGAAMAFSSVFVVSNSLRLRRFTATAS

    >gi|54022313|ref|YP_116555.1| hypothetical protein nfa3490 [Nocardia farcinica IFM 10152]
    MSRVPVWVRLALAGLITVVALAVALWPRDAGEPATGSGAPTGGAVSAQLRADAALAPCPGPAPGAVGAGPLAGLTPTCLA
    DGAPVDLAAALAGKPALLNLWAYW
    CGPCAEELPHLREYVSRVGDRVTVLTVHSDPEEAKALSRLTGLDVHLPGVLDPDAR
    VRAAVGAPAVLPISVLVRPDGSVAEVVVRTFTGVDDIAATVQRALGVPM

    >gi|54022388|ref|YP_116630.1| putative osmotically inducible protein [Nocardia farcinica IFM 10152]
    MPTRTARTAWTGGLQDGSGQVELASSGVGKYDVSFPKRSADSADGTTSPEELIAAAHSSCYAMALSAQIANAGGTPESLD
    VTADVTLGPDPAGGFRITGIQLTVRGRVQGLDADGFQAAAEAAKAG
    CPVSKALAGVDSISLDAALA

    >gi|54022561|ref|YP_116803.1| putative thiosulfate sulfurtransferase [Nocardia farcinica IFM 10152]
    MARSDVLVSVDWAEENLNTPGVVFVEVDEDTSAYDNGHIEGAVRLDWKNDLQDPVRRDFVNQQQFSDLLSARGISNDDEV
    ILYGGNNNWFAAYAYWYFKLYGHNNVKLLDGGRKKWELDGRPLSTEPVNRPATQYKASAPDLSIRAFRDEVIAAIGTKNL
    VDVRSPDEFSGKILAPAHLPQEQSQRPGHIPGAINVPWSKAANEDGTFKSDEELTEIYKEAGLDPEKETIAY
    CRIGERSS
    HTWFVLQELLGHQNVKNYDGSWTEYGSLVGAPIELGA

    >gi|54022563|ref|YP_116805.1| putative thioredoxin [Nocardia farcinica IFM 10152]
    MTEITILIVVLVLAVLIGLLIRRREGRARPAAPASTNPERAGLLAAAGVTGTGPAVLHFSAEWCGPCAAVRRVVAGVTAD
    LAAEPHPPQDIEIDIDAEPALARELNVLSLPTTFVFDAAGRERFRISGVPKAGDLRSALAPLTAADQG

    >gi|54022934|ref|YP_117176.1| flavoprotein disulfide reductase [Nocardia farcinica IFM 10152]
    MTRIAIIGGGPAGYEAALVAAQHGAQVTLIDRDGIGGACVLWDCVPSKTFIASTGMRTDLRRARDLGITLDPSQAAVQLP
    EVNARVKALALAQSSDIRSKLLSAGVTLISGTASFTDPAPGRAPHRITVRPTGERAGERVIDAEVVLIATGASPRVLPGA
    EPDGERILTWRQLYDLRELPETLVVVGSGVTGAEFVSAYTELGVQVKLVSSRDRVLPGEDADAALVLEEALAERGVELVK
    HARADAVERTADGVVVKLSDGRTVTGTHALMTVGSTPNTGDLALDKVGIELDRGGYLRVDRVSRTAVSGIYAAGDCTGLL
    PLASVAAMQGRIAMYHALGEGVSPIRLKTVASAVFTRPEIATVGVSQTAIDNGEVPARTVMLPLNTNPRAKMSGLRRGFV
    KIFCRPATGVVIGGVVVAPIASELILPIALAVQNNLTVNDLAQTFSVYPSLTGSVTEAGRLLMRHDDLD

    >gi|54022991|ref|YP_117233.1| putative thiosulfate sulfurtransferase [Nocardia farcinica IFM 10152]
    MSAVLISAEELRKELADKRVRLLDVRWALGDPDGPQHYLDGHIPGAVFVDLETELAAPPSPARGRHPLPDLAALQKCARS
    WGIREGDPVVVYDATGGMAAARAWWLLRWAGLADVRILDGGLPAWTAAGGATATGAEPDPEPGDVTLTAGNLPVVDADGA
    AKWPGVLLDARAAERYRGEVEPVDPQAGHIPGAVSAPTAENLDETGRFHDPDRLRARFARYGAGPFAVY
    CGSGVTAAHQI
    AALAVAGIDAALYPGSWSQWSNDPKRPVATGD

    >gi|54023231|ref|YP_117473.1| hypothetical protein nfa12640 [Nocardia farcinica IFM 10152]
    MTNQRLAPGDLAPAFTLPDADGNEVSLADYRGRKVVVYFYPAASTPGCTKQACDFRDNLAELEQAGIDVVGISPDKPAKL
    AKFRDAERLTFPLLSDPERTVLTEWGAYGEKTMYGKKVTGVIRSTFLVDEEGRIELAQYNVRATGHVAKLRRDLSV

    >gi|54023292|ref|YP_117534.1| hypothetical protein nfa13250 [Nocardia farcinica IFM 10152]
    MTETGKKDVADFWFDPLCPWCWITSRWILEVEKVRDIEARFHVMSLAVLNEGRDLPEQYAELMRSGWGPVRVAIAAAQQH
    GDKVLAPLYTAMGTRIHDRRADYERGSTEETLRAVIADALAETGLPAELAAAADSTDYDEALRASHHAGMDKVGPDVGTP
    TIHVNGVAFFGPVLSRIPRGEDAGKVWDGVVALASYPHFFELKRTRTEGPVFD

    >gi|54023578|ref|YP_117820.1| hypothetical protein nfa16100 [Nocardia farcinica IFM 10152]
    MPAEVGPLPVGTVAPDFTLKDQNNQPVTLSDYRGRKNVLLVFYPLAFTGVCQGELCKVRDELPKFQNDDAEILAISVGPP
    PTHKIWAAEQGYTFPLLSDFWPHGAVAQAYGVFNDKSGFANRGTFVVDKAGLIRFSEMNGPGEPRDQAAWEKALAALDS

    >gi|54023673|ref|YP_117915.1| hypothetical protein nfa17050 [Nocardia farcinica IFM 10152]
    MTVQNETTTHGVTLTDAAAAKAKALLDQEGRDDLALRIAVQPGGCAGLRYQLFFDDRSLDGDLTADFGGVTLAVDRMSAP
    YVQGASIDFVDTIEKQGFTIDNPNATGSCACGDSFN

    >gi|54023790|ref|YP_118032.1| putative transporter subunit [Nocardia farcinica IFM 10152]
    MNRPVRILAAAALAATLAACGTAHPTASDLVLTNCGAETSFPAPAHRLFVNDSNMVSMLLALGAQDQVIAVSSLQRDADT
    LRKHYGPAAVDGLSDVAPHSPSRETVLAQRPDVMVAGWNYGYTEAANLTPDSLRKDGIAAYILTES
    CRQRAGERARGVVE
    PWTALRTDLTNLGAITGRTERAADLVADLDTRLAALHAAPQAPRKPAVFLFDSGSDTIFSSGKFGAPQAILDSAGARNIL
    DDVADTWTKVSWERLASADPDAIMFVDYPGQTFEQKVELLRGKPGINELRAVREGRFLNLPYVLWTSGPLNIDAAEQIRA
    RLEQWELLPPSGIRPRADDEVR

    >gi|54023825|ref|YP_118067.1| hypothetical protein nfa18570 [Nocardia farcinica IFM 10152]
    MQTGSLAPNFALPDQTGTTRTLDELLGAGPLVLFFYPAANTPICTAEACHFRDVSAEFAALGASCAGISTDSVDTQAGFA
    TGRRLDYPLLSDADGAVAARFGVKRGLLGRIAPVKRRTFVIDTDRTVLTVISSELKADTHADEALAFLRARVK

    >gi|54023846|ref|YP_118088.1| putative thioredoxin [Nocardia farcinica IFM 10152]
    MATQTLTQQNFDEVVTGNDVVLVDFWAEWCGPCRSFAPTYEASSDKHPDVVHGKVDTEAEQALAAAANIRSIPTIMAFRE
    GVLVFAQPGALPPAALEDLVTQVKALDMDEVRKQLAEQQQGAAE

    >gi|54024696|ref|YP_118938.1| putative oxidoreductase [Nocardia farcinica IFM 10152]
    MAIMSERLVVIGADATGMAAASQARRMLGPRELKIVVFERGGFTSYSACGIPYWVGGVVTERDALIARTAEEHRARDIDL
    RMRTEAIELDVAGRRVRTRDLDSGVESWTEYDKLVLATGARPLRPALPGIDAAGVHGVQTLDDGQALIDTLDRTEGRRAV
    VVGAGYIGVEMAEALIQRGFRVTVLNRSAEPMSTLDPDMGALVRKAMDGMGIEVVGGAEVTGVRTDAHGRVRAVTTADEE
    YPADVVVLGLGVRPETTLARAAGLPLGEHDGLLTDLSMRVRGHTDIWAGGDCVEVLDLVSGRERHVALGTHANKHGQVIG
    QVIGGGYATFPGVVGTAVSKVCDLEVARTGLREKEAHAAGLQFVTVTIESTSRSGYYPEAAPMTVKMLAERRTGRLLGVQ
    IVGREGAGKRVDIAAVALTARMTVEQMTALDLGYAPPFSPVWDPVLVAARKASLAVQQRG

    >gi|54025148|ref|YP_119390.1| ArsC family reductase [Nocardia farcinica IFM 10152]
    MTSGHTEIWHNPRCSKSRNATAYLDEAGVDYTVRRYLDDPPTAEELRAVLARLGAEPWDITRTGEQAAKDLGMADWGRTP
    ADRERWIEALVAEPRLIQRPIVLTADGGAVLARSDEALRTLG

    >gi|54025193|ref|YP_119435.1| methionine sulfoxide reductase A [Nocardia farcinica IFM 10152]
    MTDTRRAILAGGCFWGMQDLIRRQPGVVSTRVGYTGGTNDHPTYRNHPGHAEAVEIVYDPERTDYRALLEFFFQIHDPTT
    KDRQGNDIGTSYRSAIFYLDDEQRRVAEDTIADVDASGLWPGKVVTEVTPASEFWEAEPEHQDYLLRYPNGYTCHYPRPD
    WKLPKRQATA

    >gi|54025306|ref|YP_119548.1| putative transcriptional regulator [Nocardia farcinica IFM 10152]
    MGEDKAAAKAALYEAFAVGGKALASAKRLELLDLLAQGERSVEALAAAAGLNLTTASAHLQTLKHAGFVATRREGVRIHY
    RLAGEDVARLLVLLRRVTAAHQPAVPPARESYLGDAGAELSSAELLARGTEGQVVVLDVRPEAEYSAGHIPGAINIPIDQ
    LSDRIAELPADTEIVVY
    CRGEYCVFAYDAVRLLTERGRRAVRLRDGMLEWRLADLPVSAEPPG

    >gi|54025705|ref|YP_119947.1| hypothetical protein nfa37350 [Nocardia farcinica IFM 10152]
    MSSDADTSLPAPRIQLTPQEWRAKLNPEEYAVLREAATERPFTGEYTDTKTEGVYSCRACGAELFRSTEKFDSHCGWPSF
    FDPAKSDAVLLRPDDSLGMRRVEVLCANCHSHLGHVFEGEGYNTPTDKRY
    CINSIALRLHPSDSAAR

    >gi|54025759|ref|YP_120001.1| putative alkylhydroperoxide reductase [Nocardia farcinica IFM 10152]
    MALLTIGDQFPAYNLTAVIGGDLSKVDAQQPDDYFTQVTSDDHAGKWRIVFFWPKDFTFVCPTEIAAFGKLNDEFADRDA
    QVLGVSVDNEFVHFQWRAQHEDLKTLPFPMLSDLKRELSTATGVLNADGVADRATFIVDPNNEIQFVSVTAGSVGRNVDE
    VLRVLDALQSDELCACNWKKGDPTINAGELLAASV

    >gi|54025912|ref|YP_120154.1| putative glutaredoxin [Nocardia farcinica IFM 10152]
    MEIKVYTRPNCQPCKATKKKLDQLGAVYTLVDVTEDAEARDAIRALGYKQAPVVVAGDQHWSGFSPDNLKWAAAVQRGVA


    >gi|54026280|ref|YP_120522.1| putative glutaredoxin [Nocardia farcinica IFM 10152]
    MTVTVYTKPACVQCNATYKALDKAGVDYEVVDITENPEARDYVMALGYLQAPVVVAGEDHWSGFRPDRIKALATVAA

    >gi|54026372|ref|YP_120614.1| putative organic hydroperoxide resistance protein [Nocardia farcinica IFM 10152]
    MQVLYTAEALATGDGRNGRSRTTDGTIDLKLAAPPALGGSGDGANPEQLFAAGYAACFHSALRLVGKSEGANVDDSAVGA
    KVGIGPNEAGGFQLAVTLEVSLPHLSAEQAQALADKAHQV
    CPYSNAVRGNIDVTVQVAED

    >gi|54026487|ref|YP_120729.1| putative oxidoreductase [Nocardia farcinica IFM 10152]
    MVMMTEESTEYDVVVIGGAAAGLSGALTLARARRSVLVIDAGEPRNSPAEGVHALFGMDGIAPAELLARGRAEVGRYGGE
    LADGEVVSARRSGDGFEVRTAAGRTVRARRLLVTTGLVDELPPIPGLRARWGRDLVH
    CPYCHGWEVRDEPIGVIAGGPNS
    IHQALLFRQWSPDVVYFTHTAEPPSAEKAEELAARDIRVVPGEITGVVVTDDRITGVRLADGSVVERTTLTVAPRMIARA
    GFLAELGLRPVEHQSGMGMHIPSDPVGATDVPGVWVAGNVTELSAQVGGAAAAGTIAAAHINADLVAADTAAAVEARRVG
    V

    >gi|54026507|ref|YP_120749.1| hypothetical protein nfa45340 [Nocardia farcinica IFM 10152]
    MNPAVTMYSTTWCGYCRRLKKQLEESGISYVEIDIEQDPASAEFVGSVNNGNHVVPTVKFADGSTATNPSLAAVKEKLAA
    LG

    >gi|54026540|ref|YP_120782.1| molybdopterin biosynthesis-like protein MoeZ [Nocardia farcinica IFM 10152]
    MSSSKSLPPLVEPAAELSKDEIARYSRHLIIPDVGVDGQKRLKNAKVLVIGAGGLGSPALLYLAAAGVGTLGIVEFDEVD
    SSNLQRQIIHGESDIGRPKADSARDSILEINSGVDVRLHKIRLEPENAVELFGEYDLILDGTDNFATRYLVNDAAVLAGK
    PYVWGSIYRFEGQVSVFWEDAPDGRGINYRDLYPEAPPPGMVPS
    CAEGGVLGVLCASIGSIMVTEAIKLITGIGDPLLGR
    LMVYDALDMTYRTIKLRRDPDRQPITELIDYEAFCGVVSEEGQAAAAGSTITARELKELLDAGKEIELIDVREPVEWDIV
    HIEGAKLIPKDRILSGEALSELPQNRPIVLH
    CKTGIRSAEALAVLKNAGFTDATHVQGGIVAWANQIDPSLPVY

    >gi|54026617|ref|YP_120859.1| hypothetical protein nfa46440 [Nocardia farcinica IFM 10152]
    MSRVAIEYCTQCRWMLRASWMAQELLSTFGTDLTEVALVPGTGGVFRITVDGEQVWERKADGGFPEITVLKQRVRDRVAP
    DRDLGHADRHVSGSGSD

    >gi|54026638|ref|YP_120880.1| putative glutathione peroxidase [Nocardia farcinica IFM 10152]
    MAEMSIRDIPLRTLSGADTTLAELVGDKAVLLVNVASKCGLTPQYSGLVELHRSYGERGFSVVGVPCNQFMGQEPGTAEE
    IEQFCSTTYGVDFPLLEKTEVNGENRHPLYAELTQVADAEGTAGDIQWNFEKFLIDRDGKVAGRFRPRTEPQDPALVAAL
    EGVL

    >gi|54026765|ref|YP_121007.1| putative methylated-DNA:protein-cysteine methyltransferase [Nocardia farcinica IFM 10152]
    MSITTADYAITDTPIGRFTALADRDGAVLAAGWTADPAELRLLVHPALRPAELRERDDLGEITRAVLAYHGGDTAAIDPV
    PVRQRSGEFLTHAWDVLRKIPAGDPVTYTEFAALAGRPAATRAAANACARNAAALFVP
    CHRVLRIGGALGGFRWGLPAKR
    WLLDHEARGGR

    >gi|54026795|ref|YP_121037.1| hypothetical protein nfa48210 [Nocardia farcinica IFM 10152]
    MWKAGTMNRLAAATSPYLRQHADNPVHWWEWEPAALAAAKERDVPILLSIGYASCHWCHVMAHESFADPATAALMNENFV
    CVKVDREERPDLDAVYMNATVAMTGQGGWPMTCFLTPDGEPFYCGTYYPKTPRGGMPSFTQLLTAVTDTWRNRRDEVDRA
    SAQVAEALRAQSSGLPEGELRIAPELLDHAVAAVVREEDRAYGGFGGAPKFPPSALLEGLLRSWERTRDPAVYGVVSRTA
    EAMARGGIYDQLRGGFARYSVDERWLVPHFEKMLYDNAQLLRAYAHLARRTVPDRSDLAARVARETAGFLLDDLGTEHGG
    FASALDADTHLEPDGPGVEGATYVWTPAELVAELGPQDGAWAAEVFGVTTAGTFEQGTSVLTRRAEPDDPERFERVRAVL
    RAARDRRPQPARDDKVVTAWNGMAITALAEGGAALGEPAWIEAAAACARFLLAEHVRDGRVRRASLGGTAGTSPGVLEDY
    AWLVTGLLALYQATGQADWLEPAQVLLDSAIAHFADPEAPGNWFDTADDAETLVARPRDPIDGATPAGASALAEALLTAA
    ALADPERAVRYREAAEQTLTRGALVLARAPRSAGQWLAVAEAAVRGPIQVAVAMPAERSSAAEALLGTARRAAPGGSVIL
    AGESGSAPLLADRAPVSGAAAAYVCRGSVCDLPVTDEKALREALARV

    >gi|54026992|ref|YP_121234.1| putative oxidoreductase [Nocardia farcinica IFM 10152]
    MTAPAPAAEYDVIVIGGGPAGENAAAYAIAGSDRTAAIVERELVGGECSYWACMPSKALLRPGHVLAAARALPGVRAEGL
    DVAAVLRRRDAIVHDHDDSGQVDWARQNRIEVIRGAGRLAGERLVEVDGRRYRARHAVVLATGTKAHVPDTPGLRDALPW
    TSRDATNLHEVPGRVAIIGGGVVACEAATWLRALGAEVTLLVRGKALLTGTEPFAGERVAEALGAAGVTVRFGTEPERVA
    REHPRDTGEGHVHGGPVTLHLRGGETLAVDEVVVAAGRGPATAGLGLDRVGLPEGYVEVDDQLTATGVAGNWLYAVGDVN
    HRAALTHMGKYQARICGDVIAARTEGRPLTGARYTASADHAQVTQVVFTDPEVAAVGLTEAAAREQGLTVRTVELDIAVA
    GSALARDDYRGHAKLVVDAEAGVPVGATFVGPGVGELLHAATVAVVGRVPMETLWHAVPAYPTVSEIWLRLSEAYRG

    >gi|54027132|ref|YP_121374.1| putative cytochrome c biogenesis protein [Nocardia farcinica IFM 10152]
    MRRPASFPAHRSAPVRVVAALLACVALVAGLAGCSTGTDAVATGGTFEFVSPGGKTDIFYDPPAARGTIGELSGPDLMTD
    GKTISVADHPGQVVVLNIWGQW
    CGPCRAEAPALERVYEATRDSGVVFLGINVRDFQQDKARDFVTDNKVGYPSIYDPAMR
    TLLALGGNFPTSVIPTTLVLDREHRVAAVFLRTLLAEDLQPVVQRIAEEGRQ

    >gi|54027197|ref|YP_121439.1| hypothetical protein nfa52230 [Nocardia farcinica IFM 10152]
    MSNNPGRRNPLLEAERADRKRKIAIQAGVAAVLIGLVAAIGIGIAVKKAERDDPGPTPAIAAQNGAAVTGSITDSGAVRI
    GKPDATVTVRVVADLQ
    CPACKNFEATYGQLLEDAVNNGTAAVEYNVISFLDRASTNEYSSRAANAAYCVAEQDPAKFQTW
    LKTMFAQQPAEGGAGHTDDQLIEIAREVGYTDAVAGCIQDRTYAKYVTSKTQAVFGEGVQSTPTVFVDGQQVQPNGLEQA
    IAAAAAGR

    >gi|54027239|ref|YP_121481.1| dihydrolipoamide dehydrogenase [Nocardia farcinica IFM 10152]
    MTSHYDVVVLGAGPGGYVAAIRSAQLGLRTAVVEQKYWGGVCLNVGCIPSKALLRNAELAHIFHKEAKTFGISGDVSFDF
    GAAFDRSRKVADGRVKGVHFLMKKNKIDEFDGKGTFVDANTLSVELSKGGTESITFDNVIIATGTVTKLLPGTSRSANVV
    TYEEQIMTRDLPGSILIVGAGAIGMEFGYVLKNYGVDVRIVEFLDRALPNEDADVSKEITKAYKKLGITITTGAAVQSID
    DDGTKVTVAIKDNKSGSVETVTVDKVLQAVGFAPRVEGYGLENTGVALTDRGAIAIDDNMRTNVPHIYAIGDVTAKLQLA
    HVAEAQGVVAAETIAGAPTLTLGDYRMMPRATFCQPQVASFGLTEEQARAEGYDVKVATFPFTANGKAHGLGDPTGFVKL
    ISDVRYGELLGGHLIGPDVSELLPELTLAQKWDLTVNELTRNVHTHPTLSEALQEAFHGLAGHMINF

    >gi|54027286|ref|YP_121528.1| hypothetical protein nfa53120 [Nocardia farcinica IFM 10152]
    MTTSTSALGAVIAANRDAVESDPAKAAVVFRAEATAHDAVASSVALRNFRVEVDEPPALGGADTAANPVEYYLASLLSCQ
    VVTWRVWAEKLGIAVEEIRAAAEGDLDVRGFFGFDDAVRPGFGEVRVTVEITGPESRERYLELQEAVDAHCPVLDLTRNT
    TPVRTTLVTPDRG

    >gi|54027342|ref|YP_121584.1| putative methylated-DNA:protein-cysteine methyltransferase [Nocardia farcinica IFM 10152]
    MSAPAPPTLAALFETPLGVCAISWRDDAVVGFRLPEPDPAALRAGFERRGVREDEPTGAIATAVAGIRAHLSGELDDLRW
    IPVDLGAVPDFHRAVYEVTRAIDPGRTLTYGQVAHRVGLPGAAQAVGQALGRNPVPLIVP
    CHRVLAADHALHGFSAPGGI
    GTKARLLEIERTPGFGEPTLF

    >gi|54027636|ref|YP_121878.1| putative thioredoxin reductase [Nocardia farcinica IFM 10152]
    MSTPVRDLIIVGSGPAGYTAAVYAARAELKPLLFEGTQFGGALMTTTEVENFPGFRNGIMGPDLMEEMREQAKRFGAEIR
    TEDVDALDLTGPVKKVTVGDETYEAYAVILAMGSAARYLNVPGEERLLGRGVSA
    CATCDGFFFRGQDIVVVGGGDSAMEE
    ATFLTKFASSVTIVHRREEFRASRIMLERAKANSKIKFVLNAEVTEVHGDTSVTGLTLRDTRTGETSHLAATGLFVAIGH
    DPRSELVRDQVELDAEGYVVVEHPTTATKIPGVFAAGDLVDHTYRQAITAAGTGCRAAIDAERWLAEQGDITDNTLDNAG
    EPVAVNAN

    >gi|54027637|ref|YP_121879.1| putative thioredoxin [Nocardia farcinica IFM 10152]
    MSENGKTVTVTDASFADDVLMSEKPVLVDFWADWCGPCKMVAPVLEEIAGTHADKLTVAKLDVDANPATARDYQILSLPT
    MMLFRGGKPVKQIVGAKGKAALLRELDGVI

    >gi|54027690|ref|YP_121931.1| hypothetical protein pnf1420 [Nocardia farcinica IFM 10152]
    MTARSVSRRTRLLTTVIAVLVIVVGAVVLAAARTDDNRPGNSVESTTGEPALAVRPDSHRLSGPTDARVTLVEFLDFECE
    ACRAMFPIMEQLRADYSDRVAFVVRYFPIPSHFNSGRAARAAQAAADQGRFEQMYQRLFETQADWGEQRAPADEVFRGLA
    AELGLDLGAYDLAYNDPATAARVRADFDEGLALGVVGTPSFFLNGEKISGGSYRDMAAALDAALD

    >gi|54027693|ref|YP_121934.1| hypothetical protein pnf1445 [Nocardia farcinica IFM 10152]
    MRPHIRWLVVFVIVFAALAAALWPRSDSTTALPERVFGQPDAATGRIEDGPPQDQRVGAPALPPCPIPGGVSAGGGPLRG
    VLARCLGSAEQVDLGVALTGEPTLINLWASW
    CAPCRSEIPVLNAYASDPDSIRVVGINVQDDPTTAAELLAELQAGYPSF
    VDGGAVQKALPAPPVLPLSFLVQRDGTVRRITTPAVFDNPAQIDATIREMTR

    >gi|54027694|ref|YP_121935.1| putative thioredoxin [Nocardia farcinica IFM 10152]
    MTHLRTTKAARHGHRYGRARHRQLRLLAAMALVIAAVTAVISCASGSDSVATGGGTFDFVSPGGQTDIFYDPPESRGKIG
    VLAGPDLMAEDKTVSVSDYTGQVVVINLWGQW
    CGPCRAEADDLERAYAATKASGVQFVGINVRDQQRDKAQDFVIDNKVS
    YPSIYDPPMRTLVALGGSYPTSVIPSTLILDRKQRVAAVFLRALLTSDLQPVIERLAAEQ

    >gi|54027750|ref|YP_121991.1| hypothetical protein pnf11020 [Nocardia farcinica IFM 10152]
    MRTDKTGSPPSFARITQALDEWAFENSRPAGPASRRGQWTMYHCPAHQDDDPSLGLIYNADKHKTVVRCFTGCSDTQVLA
    TIGLPESAIWDRQWVRVPGSPARPRAPRPEVPKARGDAPVPPKPSKKERLGKVVGPRYQAAIYHYTDHRGRPLGEVVRMH
    VPHERGTDKMFFQRKMDAGGRWSKGGFEPVLYHLPEVVQAIADGEDIHLPEGEKDVDRIRAAGRFATCNAMGAGSFRLEH
    ARQLTGARRVIIIADRDSAGYQHALQVKRMLVGRVGEVLVVEAATGKDASNHFDLGHDFDEFVPVTDEQLERGFPGADEA
    IAAAEKAMEGVFRRSFDPETGWRWQWAPEAETELGIERAPAKSVQNQQNPETTMAQTAIAPGEGVQITVYTKPQ
    CPQCDA
    TKRTLDNLGFDYRIVDVTQDSAARQRLLDMGFQGAPVVEAGDVRFSGFRPDKLKTLPGVMRADVLAEQEAAAAQPGFPST
    ADRLSVDAVQAWAGPYLRAAMRRGEIPEVGSPQWAALPNGDPRKTGAVVEAALRYVQQATAAEATAPVARSQTSTVTATA
    RNSSGRPTFAQLQEARRGEQALRAANGPLTPSAGAAAAAGASMTPASRANTSAAPQRTPGRGR

    >gi|54027878|ref|YP_122118.1| hypothetical protein pnf2680 [Nocardia farcinica IFM 10152]
    MADIELFVDPVCPFSWVSSQWLLTAAEDSAHTVRLRQMSLAVLNDGHDVAADHKPMIDRSRRLGRVFAAATRTGGAEAFA
    RLYDVIGTRLHIQGDDLGPQEVAKSLTEAGLDPGLAEHLDSTSLDDDITGTHEVSQAALGGRGGSPIVVVDGRGFNGPVL
    TEQPRPDRGRDLLDALVTAATTPGFAALQRPYQGPPKIDAATEETH

    >gi|54024268|ref|YP_118510.1| hypothetical protein nfa22990 [Nocardia farcinica IFM 10152]
    MRALRRIRNYAQAMRQARRHRGDLVGWLARRPQLGAGTAFYESMLLFSNRLDPHLKELAELKTAGLINCEFCLDIGSALA
    HSSGVTEQQITDLPRYRTSPAYSELERLVIAYAEAMTATPAVDLADLREQLLAHLSKAQLAELAATIAWENQRARLNQGL
    GVRPTGMAEGLACALPEPAR

    >gi|54026424|ref|YP_120666.1| hypothetical protein nfa44510 [Nocardia farcinica IFM 10152]
    MSEPRPNYTPRPMSNTTTFALGGVALAVIVLIVFLVFRWGKDEEAAIRNDGYGSVHDPAVPVSLAPDGLITLGKPDARVT
    LDVFEDPL
    CPACRTLERIYGQEIAQQIDAGTLAVRYHYVAFLDPKSGSGDYSTRAIAALQCVADTGDGPLYARFHDRLLV
    TDQPTEGGDDHSNSELADLARAAGAPQQAVDCINTGAKIPAATAAATSALADLNARLDDRAATPSVFHGDRKLDPNTEDW
    VVQLTK