Nitrosospira multiformis ATCC 25196 uid58361

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|82701158|ref|YP_410724.1| thioredoxin reductase [Nitrosospira multiformis ATCC 25196]
    MTSKHARLLILGSGPAGYTAAVYAARANLKPMLVTGLAQGGQLMTTTEVDNWPADAMGVQGPELMERFQKHAERFDTEII
    FDHIHTARLSEKPFTLIGDQGTYTCDALIIATGASARYLGMPSEEAYMGKGVSA
    CATCDGFFYKGQDVAVIGGGNTAVEE
    ALYLSNIARSVTVVHRRDKFRSEKIMIDKLMDKVKNGNIKLELHYVLDEVLGDESGVTGMRIKNVLDDSTKTIDLQGVFI
    AIGHKPNTDIFQGQLKMENGYIMTQAGIHGNATATSIPGVFAAGDVQDHIYRQAVTSAGTGCMAALDAEKYLDVLV

    >gi|82701188|ref|YP_410754.1| thioredoxin [Nitrosospira multiformis ATCC 25196]
    MSDSLHLVCPHCHSINRVPTARLGEQPNCGQCHQPIFAGQPLELTGSTFARYINKNDVPVLVDFWAPWCGPCKMMAPAFK
    EAAALLEPHVRLAKVNTDVEQTVGAQYRIRSIPTLILFKDGRELARQAGAMTTQDIVRWTRSQALG

    >gi|82701316|ref|YP_410882.1| hypothetical protein Nmul_A0182 [Nitrosospira multiformis ATCC 25196]
    MAETSTNIRASMAPELQTSGWLNTPHPLTLASLRGKVVVLHTFQIFCPGCVQMGIPQAQRIHQEFDPNRVAVIGLHTVFE
    HHEVMGREALEVFAYEYRLRFPIGIDKYEGTAKGVPMTMRAYQMQGTPTLILIDKTGHIRLHKFGHVSDLTVGFSIGALL
    AEEFDESAVMESSANGGENPACDTEGCKI

    >gi|82701331|ref|YP_410897.1| hypothetical protein Nmul_A0197 [Nitrosospira multiformis ATCC 25196]
    MATVIGGASGGSSPSIFIFLERSTMKTPATFYHAGCPVCVEAEHQIAEALDPDRYEVELVHLGEQKDRIAAAEAAGVKSV
    PALVINGAPFHINFGAPMSALKS

    >gi|82701345|ref|YP_410911.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nitrosospira multiformis ATCC 25196]
    MVTLAGNPIKVEGTFPKVGDKAPDFSLVNRDLKDVTLADFAGKKKVLNIVPSLDTPVCAMSTRKFNEQASNMENTVVLII
    AADLPFAMSRFCDMEGLDKVVPLSTMRGAEFMKNYGVAITDSPLAGITARAVVVLDENDKVTHAQLVPEIKEEPDYEAAL
    KALES

    >gi|82701461|ref|YP_411027.1| peptide methionine sulfoxide reductase [Nitrosospira multiformis ATCC 25196]
    MKRVVAMAAALGIIMGAYAVEKITIPAQATDYVVLGMGCFWGAEKRMGEIPGVVDVESGYAGGDLPGAGYQDILNHERAL
    RTGKTTGRNHAEVVKVVFDPNKVTLETVLAKFWESHDPTQGNRQGNDIGSNYRSAIYYHDANQKAMGLATRTAYQKALDA
    AGYDRITTEILPLKNYITAEEYHQNYLKKNPDGYCGLGGTGVKYPRAVGKVAPMQVPPISSGTSSASTSPKMGIEPLKSD
    DLNPVRQLVAFEAEHCEFCERFEKDIMSHWQAEVPIARTLNSNPPSGWALEKPLFAAPTIVLFKNGREVARYTGYNGEKS
    NFWKWLGFQLLSPEQQKIAFKRGTEPPFTASNLDEKRPGRFVDPVTGATLFYSNSKFESGTGWPSFFEPVEGAVTLHEDN
    SHGMKRIEVRSASSGIHLGHLFHDGPPPSHKRY
    CINGNVLKFVADR

    >gi|82701476|ref|YP_411042.1| OsmC-like protein [Nitrosospira multiformis ATCC 25196]
    MKASVKWQEEASFLGESGSGHTVLMDGPPESGGRNRGPRPMEMLLMGTGGCAAFDVVLILKKGRQEICDCEVRIEAERAE
    REPKVFTRIHFHFILTGKKLNPHQVERAISLSAEKYCSASIMLAKTAELTHDFEIVEA

    >gi|82701479|ref|YP_411045.1| hypothetical protein Nmul_A0345 [Nitrosospira multiformis ATCC 25196]
    MPNHLAGETSPYLLQHADNPVDWYPWGEEALTLARAQDRPILLSVGYSACHWCHVMAHECFEDAEVAEVMNRYFINIKVD
    REERPDIDQIYQTALYMLTQRSGGWPLTLFLTPDQKPFFGGTYFPKTPRHSLPGFLDLLPRVAETYRVRRPEIERQSASL
    LKSFANMLPSKAPEAPVFSERPLEQALAELKNRFDSENGGFGEPPKFLHLTELDFCLRRYFTAGNSEALHMATLTLEKMA
    EGGIYDQVGGGFYRYSTDKQWQIPHFEKMLYDNGPLLHLYADAWIASGNPLFARIVEETATWVMREMQPEYEENEKRTGA
    GYWSTLDADSENVEGKFYVWDRSEASHILSRREYVVAASHYGLSQPANFGNRYWHLAVAQSLPEIAENFGVTYAEARQWL
    ESGRKKLLAQRQCRVRPGRDEKILTSWNGLMIKGMARAGRVFGRDDWVRSAICAVDFIRSTLWKNGRLLATWKDGNARLN
    AYLDDYAFLLDGLLELMQTTFRPVDLDFAIALAEVLLDQFEDKEAGGFFFTSHDHENLIHRPKPGYDNATPSGNGVAAHT
    LQRMGYLLGEFRYLQAAERALRLFYPALLRHPDSCCSLLLALEQWLTPPPVVILRGKAEPMAKWENALRQRVPIALVLAL
    PVERVTPAALPPSLAKPVPSGMGVNAWVCHGVKCLPEVTDLQELLRISEIRGKIRSLFYN

    >gi|82701512|ref|YP_411078.1| hypothetical protein Nmul_A0378 [Nitrosospira multiformis ATCC 25196]
    MASLETPVCDFGWKAIDFNLPGVDGKHYNLASVKGEKGLLVMFICNHCPYVKAVRERIIRDVKELREQGIGAIAIMSNDP
    SDYPEDSFENMGRVAREYAYPFPYVWDETQEVAKAYGAVCTPDFFGFNHKLELQYRGRLDASRKEAAPVDARRDLFEGML
    QVARTGGGPKDQIPSIGCSIKWRAD

    >gi|82701585|ref|YP_411151.1| Thiol-disulfide isomerase and thioredoxins-like [Nitrosospira multiformis ATCC 25196]
    MKRRQMKRCHLSILLYRFCLWIMLSAVPVAQTYGFTFTDHTGKKLSLSDFKGKWVLVNFWATWCPPCLKEIPDLVSLYES
    RKKDIMVIGVAMDYRNPDVVLKHAKRLSVTYPIVLGDQELARQVGPVSMLPTTYVFDPEGKPAVYKIGIVSREALEEFMD
    ENSNKIPNSQPAGKAQQKGR

    >gi|82701649|ref|YP_411215.1| dihydrolipoamide dehydrogenase [Nitrosospira multiformis ATCC 25196]
    MAQLTEIKVPDIGDFKDVAVIEVLVKPGDTVEKETSLITLETDKASIEVPSPQSGIVKELKVKVGDKVSEGSIILMLEAT
    TAEAAAPAKASEPGGASKQEEPAEKPAANVAPPSEKEEEEKTPASVAAPAPESVAPPAAPSIPQGDIHADIVVLGAGPGG
    YTAAFRAADLGKNVVLIERYSTLGGV
    CLNVGCIPSKALLHVAKVITDAEETAQQGIAFAKPGIEIDKLRGWKESIIGKLT
    KGLTGLAKQRKVKVVRGTGRFTSPNMIEVETSDGKKTVSFEHCIIAAGSAAARIPGFPYDDPRIIDSTGALKLESIPKRM
    LIIGGGIIGLEMATVYDALGSRISVVELMDQLIPGADADLIRPLHKRIQKRYEAIYLKTKVTRIEALQEGLRVTFEGSSE
    GGGPEGTGAPEPQVYDRILMAVGRRPNGREIGAEKAGIAVNERGFIPVDKQLRTNVSHIFAIGDIAGEPMLAHKASHEGK
    LAAEIIAGGEKMKSAAFDARAIPSVAYTDPEIAWMGLTETEAKKQGIEIEKAVFPWAVSGRALAMARDEGMTKLILDKKT
    RRILGAGIVGINAGELISETVLGLEMGADMEDIGLTIHPHPTLSETVFFAAEIAEGTITDLYMPKK

    >gi|82701690|ref|YP_411256.1| HesB/YadR/YfhF [Nitrosospira multiformis ATCC 25196]
    MTDIPTPLIFTDNAANKVRELIEEEGNNDLKLRVFVAGGGCSGFKYGFTFDELISEDDTVMEKNGVKLLVDAMSFQYLAG
    AEIDYQENAEGAQFIIKNPGAASTCGCGSSFSV

    >gi|82701828|ref|YP_411394.1| HesB/YadR/YfhF [Nitrosospira multiformis ATCC 25196]
    MSITLTENAAKQIQKQLAKRGKGLALRVGVKKVGCSGFAYTYAYADELRESDRMFESCNAHVVVDVDFLPFLDGSRIDFV
    REGLNESFRFENPNVDNTCGCGESFSVKEEPAKV

    >gi|82701880|ref|YP_411446.1| methylated-DNA--protein-cysteine methyltransferase [Nitrosospira multiformis ATCC 25196]
    MIRQKSIRRVKPPEDYQARLATPFAVLGLRTDEDWLTDIEYLPPDTPTLVPQTPLAREVCDQLQAYLADPGFVFDLSLHI
    GGTVHQRRVWQAIQDIPAGATRSYAAIAVELHSAPRAVGQACGANRLPIVIP
    CHRVIAKSGGLGGFMNASDGLPLTIKRW
    LLQHEGI

    >gi|82701984|ref|YP_411550.1| dihydrolipoamide dehydrogenase [Nitrosospira multiformis ATCC 25196]
    MSQSFDVAVIGAGPGGYVAAIRCAQLGLKTVCIDEWKNPQDKPSLGGTCLNVGCIPSKALLESSENYERAARKFSAHGIK
    VEGLSIDIPAMIGRKDKIVANFTGGVAMLLKKNKVASMHGRATLLKRDRDNEADRELWQIEIRNGDKVETVGAEHVIIAT
    GSVPRQLDAAPVDNERILDNAGALALTETPKRLGVIGGGVIGLEMGSVWRRLGAEVTILEALPGFLMSADEQVAKEARKI
    FSRELGLVINTGVKISGITSGQDNVTVEYSDVDGNPQKLEVDKLIVAVGRVPNTTGLGAENVGLKLDERERIEVDVHCRT
    NLPNIYAVGDVVRGPMLAHKASEEGVAVAEMIAGQAGHLNLDAIPWVIYTSPEIAWVGKTEQELKAAGVEYKAGQFPFMA
    NGRARALGETGGFVKVLADADTDRILGIHMIGPYVSELIAEAVVAMEFAASSEDIARIVHAHPSLSEVVHEAALAVDKRA
    IHI

    >gi|82702101|ref|YP_411667.1| UBA/THIF-type NAD/FAD binding fold [Nitrosospira multiformis ATCC 25196]
    MQLSPLVHPSEELSKEEISRYSRHLLIPDVGLEGQQRLKNSKVLVIGAGGLGSPTLLYLAAAGVGTLGIIDFDIVDESNL
    QRQVIHRQQDIGRPKCRSAQDSVKALNPYIQVRIHDERLETTNAIDIISDYDLVIDGTDNFSTRYLVNDACVLAGKPYVW
    GSIFRFEGQASVFWEDAPGGRGLNYRDLYPEPPPPEMAPS
    CAEGGVLGILCASIGAIMATEAIKLITGLGNTLLGRLAVY
    DALDMTFRFIPLRRAPVRTPITRLIDYQAFCGLPQSTTGGKPNVPTISALELKEMRDCSVAMQLIDVRGIQEWNIVHIEG
    ANHIPKDRMMSEEVLARLNKDELIVLH
    CKMGVRSRDILMEMRKRGFTNVKSLDGGILAWIRDVDQTLPSY

    >gi|82702131|ref|YP_411697.1| glutathione S-transferase-like protein [Nitrosospira multiformis ATCC 25196]
    MMTLYSATTCPYSHRCRIVLYEKGMDFQIIDVDLHNRPEDLAVMSPYGRVPVLVERDLVLYESNIINEYIDDRFPHPQLM
    PADPVMRARARLFLHRFEQELFCHLEAVEHGNQKAAEKARATIRDNLTLIAPVFAKQKHMLGDEFSMLDVAIAPLLWRLD
    HYGIQLPKQAAPLLKFAERLFSRPAFIDALTASEKAMRK

    >gi|82702155|ref|YP_411721.1| hypothetical protein Nmul_A1026 [Nitrosospira multiformis ATCC 25196]
    MKSLNSEAILGALVADSAALGLHWIYDPARIAEIEAARGPRGLVFLQPEEANYAGVKGYFAHGGKTSGESSSYGEVCLLM
    LKHLARHGRFNRVEYQSEYRACFGPGGKYVGYIDSPTRLTLRTLLPLEPRDFPAASGPDDDQHPSLAAIPSLVAAHAGTL
    DELLPRVDEVVRITNNNETAVAAAQCSAAALFNLLHGMPMPQALAHALPLAGSVLRPLLEEALSMSKPDGVGATQRFGSA
    CHVTEGLPVVFHIAQTASDYRSAVETNIRAGGDSCGRSIMLGALMAAHAARQSTCEFPVPFQWLARYRKFMEAADACAAI
    Q

    >gi|82702162|ref|YP_411728.1| disulphide bond formation protein DsbB [Nitrosospira multiformis ATCC 25196]
    MSNPMRPVRSILLAIFTGCAGLIGYALYLQLVENLLPCPLCVVQRMAYWLIGLTALAGFFHTPETTGRRIYAGLMAVFAF
    TGGLVALRQAWLVRYPEAFE
    CGISPEEAFLNALPLARWWPVMFEANGDCADVTWKFASLTLPDWSAIFFMILAALSIYVL
    LVRENQRE

    >gi|82702179|ref|YP_411745.1| signal peptide protein [Nitrosospira multiformis ATCC 25196]
    MPSTLKFPSAPALHRPAGSYGSLVLRMALVLMFFLGAVDIVAAAESIRPFTSGSLKQVLASRANKPFILVLWSLDCQYCP
    TELKMLSELEKSHPGLDVVLIATDTVDDMPQLADRAGNYGTAKFEQWVFAEDMPERLRQEIDGRWYGEVPRTYFYDQKHQ
    RTVKMGLINKSLVEEWLARNAVDTANGKQNGKY

    >gi|82702247|ref|YP_411813.1| UBA/THIF-type NAD/FAD binding fold [Nitrosospira multiformis ATCC 25196]
    MNDDQLLRYSRHILLPEIGIQGQEALIRSHVLVVGAGGLGSPASMYLASSGVGTLTICDNDRVDLTNLQRQIIHGTDDIG
    APKTHSARKTLAKINPEVEVIELDERMDEKRLLQLVGDADVVVDASDNFSTRYAINHSCVLLRKPLVSGAAVRFEGQIAV
    FDLRHPDNPCYHCLFPAGGEDQDMR
    CGVMGVLAPLVGIIGCMQAAETLKILTNAGQTLNGRLLTLDGLAMKWKSSELRKD
    PGCEVCGNPA

    >gi|82702252|ref|YP_411818.1| glutaredoxin GrxC [Nitrosospira multiformis ATCC 25196]
    MSEGSAKVLMYSTGFCPYCVMAERLLRARGVEEIEKIRVDLEPARRAEMMEKTGRRTVPQIYIGDTHVGGYDDLARLDRN
    EGLAKLLAI

    >gi|82702286|ref|YP_411852.1| arsenate reductase and related [Nitrosospira multiformis ATCC 25196]
    MTDKITIYQKPTCSKCRATLALLKESGEEFEAVNYYDARLTVERLHELIDKLGIPIMDVLRREESLAHDLKLVERHRMGE
    LSDEELMKIMVENPDLIQRPIVVRGNQAVLCRPPENVTKLL

    >gi|82702337|ref|YP_411903.1| periplasmic protein thiol [Nitrosospira multiformis ATCC 25196]
    MTRFLLPLAVFVVLVGFLLVGLGLNPRQVPSPLVGKPAPEFQLQQLHEPEKTLTSKENLGKVWLLNVWASWCVSCRQEHP
    VLVELSKSGIVPVYGLNYKDQRDDALRWLQQFGDPYAVSAVDPEGRTGIEFGVYGVPETYVIDKNGVIRYKQIGPVTVEA
    LQNKILPLVRELQG

    >gi|82702462|ref|YP_412028.1| hypothetical protein Nmul_A1333 [Nitrosospira multiformis ATCC 25196]
    MISLRLHLRRMPEKPEPWSGYNIGMDTVHGSEPSRAEIDSLQGPALVEFGAAWCGYCRAARPLIASALSGAPPVRYIRIE
    DGKGRRLGRSFGVKLWPTLIFLKDGKEIARLVRPENPGLIQRALENICKDA

    >gi|82702639|ref|YP_412205.1| hypothetical protein Nmul_A1510 [Nitrosospira multiformis ATCC 25196]
    MSQSNLQRSMPIVTLPDLFDARFDNRFVRQLPGDPETRNVPRQVRNAGYTQVSPTPVRSPRLLAWADEVGEMLGIARPAS
    PVSPAVEVLAGNRILPSMQPYAARYGGHQFGHWAGQLGDGRAITLGELISPNDKRYELQLKGAGKTPYSRTADGRAVLRS
    SVREFLCSEAMHSLGVPTTRALSLVATGEAVIRDMFYDGHPGAEPGAIVCRVSPSFLRFGNFEILAAQKEPELLRQLADF
    VIGEHFPELASSHRPPEVYAKWFEEVCRRTGILVAHWMRVGFVHGVMNTDNMSILGLTIDYGPYGWLEGFDLHWTPNTTD
    AQGRRYCYGNQPKIAQWNLTRLAGALTPLIEDDAALEHGLAVFGETFNNTWSGMLAAKLGLASLEHSDDDSLLSDLFETL
    QQVETDMTLFFRCLMNIPLNPISGNRATTFPAPENLESVDQMNDHGLVELFRPAFYDAHQAFSHAHLTRLAGWLRRYIAR
    VRQEGEPEGLRYHRMSRANPKYVLRNYLAQQAIEALERGDDSVIIRLMEMLKHPYDEQPEHEDLAARRPEWARNKPG
    CSA
    LS
    CSS

    >gi|82702645|ref|YP_412211.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Nitrosospira multiformis ATCC 25196]
    MKSTGVVDCLIIGAGPGGLTAAIYLARFRRHITIVDSGFSRAALIPTTHNCPGFPMGISGNEFLDRLRLQAAQYGVEVQA
    GEVLRLRQVENFFEAHVSNSAGSGTSRHRGGDGGGAGGMSIRAVTILLATGTADSRLDTSDWKTCIRKGLIRL
    CPICDAY
    EATDQNIALLSSSPREGVKHALFLRTYSRNVTLIYQAKAELTSAEKRRLRKVNVEVIEDALGSLHITGESKPSIRLSNGE
    ELPFDVIYPMLGESPRSQLAVQLGARCNREGKLIVDRHQRTTVAGVYAVGDVVDGLNQISVAAAHAAVASTDIQNRLNRL
    GYRLCP

    >gi|82702667|ref|YP_412233.1| OsmC-like protein [Nitrosospira multiformis ATCC 25196]
    MTIKKAWAVWKGGIKDGGGTISTETGVLSEAPYGFKSRFENGKGTNPEELIGAGHAGCFSMALSLMLGEAGLTPEKIETH
    TAVTLDKVGEGFEITTIHLDVAARIPGADQAKFEEIANKAKEG
    CPVSKLFKAKITMEARLET

    >gi|82702873|ref|YP_412439.1| glutaredoxin 2 [Nitrosospira multiformis ATCC 25196]
    MTVPDPDLPVLLTVYGREHCHLCQDMLAALQELKASHPFQLEVVDVDSDSDLQSRYGQRVPVLMAGDSEICHYHLDLNAF
    DRIFQRI

    >gi|82702925|ref|YP_412491.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nitrosospira multiformis ATCC 25196]
    MKVLGVLATLATLIMTFGSRGVLAEPLKVGEAAPDFNLPDQNGKNHKLSDYHGKWLALYFYVKDDTPGCTKQACKFRDDI
    HQLRDLGAEVVGVSVDDSASHASFAKKYDLPFPLLADSKGETAKRYDSIWSLIGLAKRNTYLIDPEGRIAKIYLSASASR
    NSAEIIEDLKRMKGS

    >gi|82703066|ref|YP_412632.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nitrosospira multiformis ATCC 25196]
    MLNQPVPDFELPSTSNKTFRLSATREKNLVIYFYPKDDTPGCTTEGQEFRDAYTEFTDADCDIVGISRDNIKSHEKFKAK
    MNFPFELLSDTDETVCNLFGVMKMKNMYGKQVRGIDRSTFVVDTKGILRREWRSVKVTGHVQEVLEFVKTLPNENHES

    >gi|82703081|ref|YP_412647.1| ADP-ribosylation/crystallin J1 [Nitrosospira multiformis ATCC 25196]
    MSDPTIQNRAAGAVMGAFIGDALGLGPHWYYDLAVLRRDYGDWITTYTDPKPGRYHSDLKAGQLSQTGIILRLMLRSLVE
    RGGYDEADFCQRMDEEIFPFLNGMPVNGPGGYTQQSIRDTWRKRVQENQPWGQTGGQADTTEAIGRTLALAVRYAFQPQE
    MAAVVSSNTRLTQIDGTVVTLTVAYGSVLSLLVQGHQLNRSLSGKLMRLARAGKLPFHTMAHTDLQPPQEDLPCESGYSV
    SPDALLTPSYIAAAALDPDIRIEPAWKVSIVYGMT
    CAIYHQLPAAYHLTARFPNDFESAVLHAVNGGGENQARAALTGAL
    VGAQVGLSGIPRRFLDGLYEGEALQSLAMDLGSKVGTSIGEGKS

    >gi|82703195|ref|YP_412761.1| dihydrolipoamide dehydrogenase [Nitrosospira multiformis ATCC 25196]
    MILAVQLAAQGGSTAFHTNSCNISDEEEILVSETFDVIIIGAGTAGLAALREVKKRTDNFAIINDGPWGTVCARVGCMPS
    KALIEAAKAFHRRTSFEEFGIQGAHCLTPDIAAVLRRVRRLRDDFVASTLKATEVLGERAISGRARLLEAGRLEVNGREL
    RARNIIIATGSRPVVPSPWLALDTQILTTDTLFEQKTLPDRVAIIGLGAVGVEMAQALGRLGIEVTAFSESDTIAGLSDP
    KVNAVAAELFADEFRVHLGKRADLRVADGGMRVTTGTQETAVDAVLASLGRRPNIENLGLETLGIPLNERGLPPVDPHTM
    QIADLPVFMAGDASGMRPLLHEAADEGHIAGINATHPTPIRFDRRTPLAIVFTDPGIAIVGKKHTSLPRGTLTGEVRFEP
    QSRARMAQRNDGILRIYAEPGSGKLLGAEMCSPDAEHMAHLLALAIDRSLTVHDMLRMPFYHPVLEEGLRTALRELSKQL
    PHCRESDLAGCEAFGAQALD

    >gi|82703204|ref|YP_412770.1| thioredoxin [Nitrosospira multiformis ATCC 25196]
    MSHTHHISDGNFETEVLQSTVPVLVDYWAEWCGPCKMIAPILDEVAKEYGDRLKVAKLNIDENQATPPKYGIRGIPTLML
    FKNGNIEATKVGALSKSQLTAFIDSHI

    >gi|82703229|ref|YP_412795.1| protein-methionine-S-oxide reductase [Nitrosospira multiformis ATCC 25196]
    MNDKLVKSDQEWKNQLTPQQYHVCREKGTERAFTGEYWNCHDQGVYRCACCGAALFDSDTKFDSGTGWPSFWQPTRSENV
    VNQEDNSHFMRRVEVLCARCDAHLGHVFEDGPAPTGLRY
    CINSASLKLDRDSSKTE

    >gi|82703394|ref|YP_412960.1| heavy metal translocating P-type ATPase [Nitrosospira multiformis ATCC 25196]
    MSSLTLRHIELPIEGMTCAACATRIEKNLNKLPGVQAAVNFANEKARIEFDTSATQPQDLVHSIEKAGFHVAPQSVQLQI
    TGMT
    CAACSGRIEKALSKLPGVAASVNLATETAHVSYNPAMETVEDIINAVVKTGYGARELSDTSRAEEKARKLAAYQAE
    LRMFWISVALSAPLLVQMGPMFWGGEMELLPRWLQLLLATPVQFWIGKRFYVGAWHALRGGGANMDVLVALGTSMAYLFS
    AMVTLLGLDQHVYFEASTAIITLVLLGKLMEARAKSRTSAAIEELVKLQPRTARVERNGEIIEVDVSTLEVGDIFLVRPG
    ESLPVDGVVLEGASSINEAMLTGESLPVAKQAGATVYAATVNQQGMLKCRATGVGAHTQLAAIIRLVEEAQGSKAPIQRL
    ADTISGIFVPIVTAISALTFILTWWLAGNFVPALVSAVAVLVIACPCALGLATPTAIMVGVGRGAQSGVLVKNAAALEHA
    GKIETLILDKTGTLTEGKPALTDVVTAGSFTERELMRVATALEQGSEHPLAKAVMEHASKTGIQPESVTNFQAVTGSGIT
    GNIGDTGYILGSPGFLREHGARIDENAVSALQSEGKTVIGLAAVKTPSDKESAEVLGYLAIADQLRITSARAVARLKAMG
    IEVVMLTGDNAPTAAAIAGQAGITAYRAEVLPQDKAAEVGKLKESGKVTGMVGDGINDAPALAMADVSFAIGAGSDVAIE
    AADITLMRDDLMSVVDAISLSRRTLGKIRQNLFFAFFYNVLGIPLAAMGLLNPVIAGAAMAMSSVSVVSNSLLLKRWRAS
    A

    >gi|82703429|ref|YP_412995.1| peroxidase [Nitrosospira multiformis ATCC 25196]
    MTLRLGDTAPDFEQESSIGRIKFHEWIDDSWAVLFSHPADYTPVCTTELGMTAKLKSEFDKRNVKAIGLSVDPAAKHTGW
    IKDIEETQGCTVAFPIIADEDRKVAALYDMIHPNQSETMTVRSLFVIDPKKKVRLILTYPMSTGRNFDEVLRVIDALQLT
    DNYTVATPANWNDGGDVIIPLTIQDEAVIKQKFPKGYTAPRPYLRITPQPNK

    >gi|82703502|ref|YP_413068.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nitrosospira multiformis ATCC 25196]
    MAVLVTHPAPDFTKPAVLADGTFNDNFNFHAQIAGKYAVLFFYPLDFTFVCPSEIIAHSHRIEEFRKRNVEVIGVSVDSQ
    FTHYAWRNTPVDKGGIGPVGITLVSDVGGDIMHAYGIAHPDHVALRASFLIDKNTIVRHEVVNDLPLGRDVDEMLRMVDA
    LQFHESHGEVCPAGWKAGEPGMKASPEGVAEYLESHGEAL

    >gi|82703560|ref|YP_413126.1| putative thiol:disulphide interchange protein [Nitrosospira multiformis ATCC 25196]
    MRSKLVSLALPSLLLCFLSSASADEASLKKALQANFPGEKVESIKKTPYLGLYEVVVGGELFYTDDKASYLFFGHVIDPK
    TKESLTSERLQQIKEARRIDVGSLPLQHAIKAVKGNGKRKLVVFSDPN
    CPFCKRLEKELVNVTDVTIYTLLYPVLNGSTP
    TATAIWCSEDRLKAWEDFMLRNIMPASKDCATPIDVILKAGKENDISGTPTLIFANGSVTPGLIPAETIEKKLNAAPAK

    >gi|82703567|ref|YP_413133.1| methionine sulfoxide reductase A [Nitrosospira multiformis ATCC 25196]
    MTEKAIFGAGCFWGVEAAFRAVKGVKEVTSGYSGGHMKNPSYRDVCTDKTGHAEVVQVEYDPSQVSYDELLDVFWNCHNP
    TTLNRQGPDVGKQYRSAIFFYTPEQESAARASKEKLEQSGRWRAPVVTEITPASDFYPAEEYHQRYLEKRGISGHCHM

    >gi|82703569|ref|YP_413135.1| DSBA oxidoreductase [Nitrosospira multiformis ATCC 25196]
    MNLLRLLTAFLLLAGIGFPSISPARADIVEGKDYTVLPRPFPAEGGKNIEVMEFFWYGCPHCYELHPRIKAWLKHKPADV
    SFRYVPAVFRPTWAPAAKTFYALEALGEKDRLHDKVYDAIHRDGIDLGKEDVLFDWIAKQGIDRQKFIDVYNSFSVQNQL
    SRSVHFSKDYGLTGVPAIAVDGRYLTSGRMGSTPDDTIRTMEELIQKVRKERTGK

    >gi|82703752|ref|YP_413318.1| glutaredoxin-like protein [Nitrosospira multiformis ATCC 25196]
    MDTQEIIKQQVTTHPVVLYMKGSPAAPQCGFSAHAVKILNACGVDDLFAVDVLAEPEFRQGIKDYSNWPTIPQLYVNGEF
    IGGSDIVSEMYQSGELQKLLESAEAK

    >gi|82703778|ref|YP_413344.1| electron transport protein SCO1/SenC [Nitrosospira multiformis ATCC 25196]
    MSLAKRSVLISALVTSLGTWVFWWGTDGFTAFTAETARRVEILRSPRALPDVTLEDQNGKIFHLKDYQGKLLAVDFIFTR
    CTTLCRSMGMIFKQIRDLIPEESLGRDFALLSISFDPEHDDPASLKKYGEAYGADGEIWRIARVRDKAELQSLLDAFGII
    VIPDQFGGFEHNTALHLVGRDGRLRLISDIDKAVPFAEQVVALL

    >gi|82703795|ref|YP_413361.1| thioredoxin [Nitrosospira multiformis ATCC 25196]
    MTKLRQVLLYTGVAILAVAAGVLLRGQLGSNDVASPPDAAVATKGAEAILAASFPDLEGNIQPVSQWRGKVMVVNFWASW
    CAPCREEIPEFISFQDKFRDKGLVFIGIAVDQKERAAAFSKEMGINYPVLVGDMKAMQIAGAAGNIQGALPFTVVIDRNG
    KMIGSKLGRLSESKLESMIGPLL

    >gi|82703796|ref|YP_413362.1| protein-disulfide reductase [Nitrosospira multiformis ATCC 25196]
    MPLNRYSRYSLLFLCLFSTSVFAEEGKTSGFLSGLQQLRSTLGQDQEEQELLPPDEAFKLKVKARDANTLVAQFEPAKNY
    YLYKDKVAFKPQTPGTTVENISLPQGEMKSDVTFGEVEVFNEPFEALISLKRTAPSGDKLTLVATYQGCNEPIGVCYAPI
    SKVIDLTLPVAKAAAGAVANAMSADASAATGSAGERLDATDELFQSKDGSAAIETESLEIERMFQTGNFWLILTGFFGIG
    LLLSFTPCVFPMFPILSGIIAKGGQHVTKQRGFILALAYVLGMAITYAIAGVAAGLSGAMLSATLQNAWVLGAFALIFVT
    LAFSMFGFYELQLPTFFQSKISEEAGHLKGGHLTSVFGMGALSALIVGPCVAAPLAGALLYISQTRDVVLGGSALFAMAL
    GMGLPLLLLGASAGALLPKAGAWMEGVKQSFGVLLLGVAIWLISPVIPAVVHMLLWAALLIVSAIYLHAVDPLRPDASGP
    QKFLKGIGMIALLTGIALLVGVFSGSRDILQPLSKLNISAAGMEGAKKDGLNSNEHLPFQRVKSVAELNQQILQSRNKYV
    MLDFYADW
    CVSCKEMERFTFTDPAVQARLKDVVLLQVDVTAGTPEDMELLKRFKLFGPPAILFMDKEGRQVPNVKIIGYQ
    DTPAFLKILNAVLI

    >gi|82701326|ref|YP_410892.1| electron transport protein SCO1/SenC [Nitrosospira multiformis ATCC 25196]
    MRHRPHYYRLVVWIAAALLTAPLLSACSKTEKPAFLSTDITGADFGKDFNLTDHNGKMRTLADFKGQVVTVFFGYTHCPD
    ACPATMGNLAAAMDMLGADASRVQVLFITVDPERDRPEVLKAYLSAFNPSFLGLYGDERAIKKTTKEFNVVYQKQQGGAH
    QHDSVDHSTGTYIYDTKGKLRLYVSNDKGADVFAHDISQLLKTSG