Nitrosomonas eutropha C91 uid58363

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|114326589|ref|YP_743748.1| putative mercuric reductase [Nitrosomonas eutropha C91]
    MYLNITGMTCDSCATHVKDALEKVPGVLSALVSYPKGSAQLATDPGTSPEALTAAVAGLGYKATPADAPSTSARGRLLGK
    ALGWLGGGDKAGGDGDGLHVAVIGSGGAAMAAALKAVEQGANVTLIERGTIGGT
    CVNVGCVPSKIMIRAAHIAHLRRESP
    FDSGIAATVPAIDRSKLLAQQQARVDELRHAKYEGILDSNPAITVLHGEARFKDDQSLAVRLNDGGERVVAFDRCLVATG
    ASPAVPPIPGLKESPYWTSTEALVSDTIPERLAVIGSSVVALELAQAFARLGSKVTILARSTLFFREDPAIGEAVTAAFR
    AEGIKVLEHTQASQVAHVDGEFVLTTGYGEIRADQLLVATGRAPNTRSLALEAAGVAANAQGAIVIDKGMRTSTPHIYAA
    GDCTDQPQFVYVAAAAGTRAAINMTGGDAALDLTAMPAVVFTDPQVATVGYSEAEAHHDGIETDSRTLTLDNVPRALANF
    DTRGFIKLVIEEGSGRLIGVQAVAPEAGELIQTAVLAIRNRMTVQELADQLFPYLTMVEGLKLAAQTFSKDVKQLSC
    CAG


    >gi|114326591|ref|YP_743750.1| mercuric transport protein periplasmic component [Nitrosomonas eutropha C91]
    MKKLFAALALAAVVAPVWAATQTVTLSVPGMTCSTCPITVKKAISKVEGVSKIDVTFETREAVVTFDDAKTSVQKLTKAT
    GDAGYPSSVKQ

    >gi|114326592|ref|YP_743751.1| putative mercuric transport protein [Nitrosomonas eutropha C91]
    MSEPQNGRGALFAGGLAAILASACCLGPLVLIALGFSGAWIGNLTVLEPYRPIFIGAALVALFFAWRRIYRPAQACKPGE
    VCAIPQVRATYKLIFWIVAALVLVALGFPYVMPFFY

    >gi|114330046|ref|YP_746268.1| redoxin domain-containing protein [Nitrosomonas eutropha C91]
    MIGVGPFPIQVFTIIGAVLLGWMTARFVARRMPEVSYKTAGSMILDAVVWGLLAARLIYIAQWWDEYSAKPMSMLAIGDR
    GFSWWAGIVVAVAYIWWRTRLTQALRGPVLAGVMVGVVAWAVAGGVLNLMQSSAPPLPDLQLATLDERSISLSAYAGRPI
    VLNLWASW
    CPPCRREMPVFEQAQTEFPGVAFVLVNQGENPKQAQAFLESEGLKLTDILLDPASELMRLMGSRGLPTTLFF
    DAQGRMVDSHLGEITMPSLKDKILRRFDRSSVSGTGK

    >gi|114330060|ref|YP_746282.1| heavy metal translocating P-type ATPase [Nitrosomonas eutropha C91]
    MTAHDHKHTHLGQPGDLSGGSTPLGENHAKLPESPVSTLKDPVCGMSVTEQSPHHLELDGQLFYFCSTGCQAKFSAGPAK
    YLSKSQSSEQSTQAAAPGTIYTCPMHPEIRRDHPGN
    CPKCGMALEPLMPTLDDDNPELADFTRRFWWTLPLTIIVTTLAM
    FGHQFGWFGMTAQSWIELVLSLPVVLWAGWPFFVRGVQSVINRSPNMWTLIGLGTAAAFIYSVVATVTPEVFPDTFLSMG
    RIAVYFEAAVVIISLTLFGQILELRARSQTSAAIKSLMGLAPKTARRILPDGTEEDVPLTHVHEGDRLRVRPGEKVPVDG
    AVEEGASSIDESMLTGEPLPVSKRVGDKVIGATMNTSGALVIRAEKVGAATVLSQIVQLVAQAQRSRAPMQRMADHVAGY
    FVMAVVAIAVITFFVWGFWGPQPSWVYGLINAVAVLIIACPCALGLATPMSIMVATGRGATHGVLFRDAAAIENFRKVDA
    LIVDKTGTLTEGRPTFEQAVPVQGVSADEVLRLAASLDQGSEHPLADAIVNAAREQGIALATVDEFESGSGIGVRGKVES
    KRLALGNTALMQQEGVDVARLSEKADRLRVQGASVMYLAANGDLLGLLAVSDPIKASTQEALNELKAAGIRVIMATGDGV
    STAQAVAQRLGIDEFHGEVKPADKLDLVTKLQDQGHIVAMAGDGINDAPALAKADVGIAMGTGTDVAMNSAQVTLVKGDL
    RGISIARHLSDATIANMEQNLGFAFVYNALGVPLAAGVLYPWTGLLLSPMFAALAMSLSSASVVTNALRLRKAK

    >gi|114330063|ref|YP_746285.1| putative mercuric reductase [Nitrosomonas eutropha C91]
    MKTPSRCLLHPSIYWKKMTEITVNGMTCISCATDVKVALEKIPGVNGAVVSYPESRARVSADAAVAVSHDQILAAIAALG
    YQGSIRVGDFKSDTKSRDALEGAGLHIAVIGSGGAAMAAALKAVEQGAHVTLIERGTIGGT
    CVNIGCVPSKIMIRAAQIA
    HLR
    CESPFDGGIAATVPAIDRSKLLAQQQARVDELRHAKYEDILDGNPAITVLHGEARFKDDQRLVVRLNGGGERVVAFD
    RCLVAAGASPAVPPIPVLKESPYWTSTEALISDTVPERLAVIGSSVVALELAQAFARLGSQVTILARNTLFFREDPAIGE
    AVTAAFRTEGVQVLEHTQASRVAHVDGEFVLTTGFGEILADKLLVATGRTPNTRSLELEAAGVAVNAQGAIVVDQGMRTS
    NPNIYAAGDCTDQPQFVYVAAAAGTRAAINMTGGDAALDLTAMPAVVFTDPQVATVGYSEAEAHHDGIETDSRLLTLDNV
    PRALANFDTLGFIKLVADAGSGRLIGVQVVAPEAGELIQTAALAIHNRMTVQELADQLFPYLTMVEGLKLAAQTFSKDVK
    QLSC
    CAG

    >gi|114330065|ref|YP_746287.1| mercuric transport protein periplasmic component [Nitrosomonas eutropha C91]
    MKKLFASFALAAVVAPVWAVTQTVTLSVPGMTCSTCPITVKKAISKVEGVSKVDVTFETREAVVTFDDAKTSVQKLTKAT
    GDAGYPSSVKN

    >gi|114330066|ref|YP_746288.1| putative mercuric transport protein [Nitrosomonas eutropha C91]
    MFPPQSGRGVLFTGGLAAILASACCLGPLVLIALGFSGAWIGNLTVLEPYRPIFIGVALVALFVAWRRIYRQTAACKPGE
    VCTIPQVRATYKLIFWVVAALVLVALGFPYVVPFFY

    >gi|114330089|ref|YP_746311.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Nitrosomonas eutropha C91]
    MSRFVWPLVGFIVLVGFLAFGLTLKPSEVPSPFINKPAPSFTLPQLASPEDTFSPEAMKGKVWLLNVWASWCYACLEEHP
    VITALAKTHGVPIVGLNYKDIRGEAISWLERHGNGYVLSVSDTQGRVGIDYGVYGVPETFVIDKDGFIRYKHIGAVTDSA
    VRDTILPLIRELEQ

    >gi|114330098|ref|YP_746320.1| heavy metal translocating P-type ATPase [Nitrosomonas eutropha C91]
    MNTLTIQESALTTAISLPIEGMTCASCVGRVEKALSKVDGVDSVTVNLATERADIKANGPLDRQVLVNTIEATGYSVPAT
    TIDLAVEGMT
    CASCVGRVERALKAVPGVSEATVNLATERAHVRGSVDSNALITAIVAAGYVAQPIDVGASTDEDAANERK
    DAERAALKRDLTLAAVLTLPVFVMEMGSHLIPGVHDLILRTIGAQWNWYIQFALTTLVLAVPGIRFYRQGIPALFRLAPD
    MNSLVAVGTLAAYAYSLVATFAPSLLPVGTVNVYYEAAAVIVTLILLGRFLEARAKGRTSEAIKRLVGLQAKTARVQRNG
    AVIEIPIADVAAGDIIEVRPGERIPVDGEVTQGQSYVDESMITGEPIPVAKTVDSKLVGGTVNQKGALSFRATAVGGATV
    LSQIIRMVEQAQGSKLPIQALVDKVTMWFVPAVMGVAVLTFLVWLVFGPQPALTFALVNAVAVLIIACPCAMGLATPTSI
    MVGTGRGAELGVLFRKGEALQLLKDAKVVAVDKTGTLTEGRPTLTDLEVANGFQRQNVLSRIAAVEAKSEHPIARAIVEA
    ADNEGIAIPDITDFESITGFGVKAHVNGELIEVGADRYMRKLGLKVDVFSATAERLGNEGKTPLYAAIDGRLAAIVAVAD
    PIKETTPDAIAALHNLGLKVAMITGDNRRTAQAIARQLGIDEVIAEVLPEGKVEAVRKLKAAHGQLAFVGDGINDAPALA
    EADVGLAVGTGTDIAIEAADVVLMSGNLMGVPTAIALSRATIGNIRQNLFWAFAYNTALIPVAAGVLYPAWSILLSPIFA
    AGAMALSSVFVLGNALRLRGFRPPIEATKSSQLPTTA

    >gi|114330111|ref|YP_746333.1| hypothetical protein Neut_0080 [Nitrosomonas eutropha C91]
    MQPPTPSFRDTLRSLIWPAVIMALTFLVFWRPSVPSASIEQGTQPSAANSAAMSQVSGPPWHHGSHTARFTLILYADLEC
    PYCRTYVPPLMAWIERHPDIRLQWQHLPLSMHEPAASELAALAECAGEAGGPEAYWRTISWIYQYTRGEGLGLPDGMYPP
    DHEALYACLASERPLAIVRTQAQGAASNGIAATPTLHLRDERTGQSLWLQGPIPGDALLSAMDLLVTDEPASELAETTEL
    SAVPDGNKPR

    >gi|114330112|ref|YP_746334.1| DSBA oxidoreductase [Nitrosomonas eutropha C91]
    MNRRLLVISICVLSLIVFTVAAFLLRPANSPVPASVQTPIAAQDLATLVRFHSPVIGRLDAPITIVEFFDPSCEGCRAFY
    PHVKQILSKYPNDVRLVLRYVLFHEGSEQTVRMLEAARKQGLFQPVLEAILEAQPEWHDDPKVTAAWRAAVRVGLNEGRA
    RTDIQEAAISALIKMDEADVNAVGIKGTPTFFVDGKRLAKLNPQDLLNAVEGALVLQRK

    >gi|114330115|ref|YP_746337.1| heavy metal translocating P-type ATPase [Nitrosomonas eutropha C91]
    MSSAKALKLRIEGMDCGACAVKIENAMKRLPGVTDINVSYGRESLALSFDEDRSSQHNIEAQIRALGFTPVREGAVGTRA
    SAAERESLPFWAGKKAKLVWMTGLAFAVAVGIAQFFPQWERWAYSAAAFVGIIPVVRRAYASAITGTPFSIETLMSVAAL
    GALAIDAAEEAAVVIFLFAVGELLETVAAGRARSAIKALMDLAPRQAIREQDGKLETVPVEQLAIGDIAIVRPGDRVPSD
    GSVLEGISEVNEAPITGESVPVAKEPGANLYAGSINGNAELRMSISRAASDNTIARIIHMVEEAQESKAPLARFIDRFSS
    IYTPVAMVVSLLIVIVPPLLFGGDWMTWIYRGLATLLIACPCALVISTPAAIASGLAVGARRGLLVKGGAALETLGKLKT
    VAFDKTGTLTEGRPRITDIVTLNGTEDEVLARAAAVERKTSHPLGAAIVEAAEARNLELPQSFGAALAIPGKAVTARLKS
    GFASVGSPRYAEELAPIEESVRQTISALEQAGKTVVVVLAGKRIDGLIALRDEPRQDAAQALKRLADMGIKTVMLTGDNR
    RTGDAIGRALGVGVQAELLPEAKLAAIDGLKQDGHVAMVGDGINDAPALATASVGVAMGGGTDVALETADAALLQNRVMG
    IADLIDLSRATLGNIWQNIGLALGLKAIFLVTTILGVTTLWMAILADTGATVLVTANALRLLRYRSQD

    >gi|114330344|ref|YP_746566.1| methyltransferase type 11 [Nitrosomonas eutropha C91]
    MHNIVQDSVKDYYGRQLQHTGDLKTSTCCDISAMPAWLKPVFEHIHPEVLSRYYGCGLVCPPLLEGCRVLDLGCGSGRDV
    YALAQLVGPTGEVIGIDMTDEQLAVAVKHKAFHVQSIGYDNVRFLHGYIERLDELDLEPGSFDVIVSNCVVNLSPDKDAV
    LRGVQYLLKDGGEFYFSDVYADRRVPAAVRDDSVLYGE
    CLGGALYWNDFLRLAHRHGFLDPRLVTDRPLQITDPALAPRV
    GDVRFFSANYRLFKLGDLETACEDYGQAVIYRGTIPYCAERFVLDKHHAIDTGRVFPV
    CGNTWRMLHDSRFASHFDFIGN
    FERHFGLFDGCGSKLPFDMNTSLSGSGGTCC

    >gi|114330438|ref|YP_746660.1| OsmC family protein [Nitrosomonas eutropha C91]
    MSAPDTKNIVNGINIEQSFVIQKQISEDRSGDMAKPKYQATVVWDSGYHTTANVTDGQTIIGDEPPRYGGKGTGISPQDM
    LLTAVGH
    CLAASYIGGLSAARINVESLRLHVSGRVNFGVAYAVEAGNPGFEDINVVVEIQTDTPQEKVLALLEKLKQTAP
    IPDTIMRPVPVNIEIHHQPK

    >gi|114330440|ref|YP_746662.1| peptide methionine sulfoxide reductase [Nitrosomonas eutropha C91]
    MTPSSVNSNQTTDSKSNYIVLGMGCFWGAEKRMGELPGVVDVESGYAGGDHAGVGYEDILNFERALRIGRAAGRNHAEVV
    KVTFAPEQVSLESVLAKFWESHNPTQGDRQGNDIGSNYRSAIYYHDEDQKTLALATRDTYQQALTAAGYGQITTEILPLK
    NYITAEEYHQNYLKKNPDGYCGLGGIGVKYPAADHTKDTTTTSAAPSVQPLDSKDLNFDRQLVVFESENCEFCVQFKQDI
    LDHWQADVPMIVTMNANPPTDWVLDKPLFASPTMVLFSKGKEVARYTGYNGEKEKFWQWLGFQLLTPEQQKIAFEQGTER
    AFTGSNLDEKRPGRFVDPITGVTLFRSQTKFNSGTGWPSFFEPAEGSVTYHKDNSGYMQRIEVRSASSGIHLGHVFNDGP
    PPSHKRY
    CINGNVLKFVPD

    >gi|114330461|ref|YP_746683.1| arsenate reductase and-related protein [Nitrosomonas eutropha C91]
    MGDRITIYQKPTCSKCHEALTILKESGNEFDSINYYDTRLTIDMLREIVRKLGIPARGLLRADEPLAKGSESANDEELLQ
    LMAANPDLIQRPIVIRGDSAVLGRPPEKIKKLLGG

    >gi|114330672|ref|YP_746894.1| glutaredoxin 3 [Nitrosomonas eutropha C91]
    MDDNGAERDKMPKVVMYVSGFCPYCTMAEKLLRARGVEEIEKIRVDLQPGQRTEMMRRSGRRTVPQIYIGQTHVGGYDDL
    SMLDRQGELASLLAG

    >gi|114330730|ref|YP_746952.1| hypothetical protein Neut_0715 [Nitrosomonas eutropha C91]
    MLSTGVFCGSFITLIKTMLKSAHALYRARRVVKNSGQNKLLSDYQGKVLRMMNITSQCGFELQYQGLEMLYRHYREDKPE
    SPASDIEQLL

    >gi|114330804|ref|YP_747026.1| thioredoxin reductase [Nitrosomonas eutropha C91]
    MTTTRHCKLLILGSGPAGYTAAIYAARANLNPVLITGMAQGGQLTTTTDVDNWPADVAGVQGPELMERFLKHAERFQTEI
    IFDHIHTAKLSGKSFELTGDQGTYTCDALIIATGASAKYLGLPSEEAFMGKGVSA
    CATCDGFFYKNQDVAVIGGGNTAVE
    EALYLSNIARKVTVVHRRDKFRSEKILIDKLMEKVQSGKIELALDHVLEEVKGDDSGVTGVRIRHVRDDTARDLDLQGVF
    IAIGHHPNTDLFQGQLEMKNGYIITQGGNEGNATATSIPGVFAAGDVQDHIYRQAVTSAGSGCMAALDAERYLEKSS

    >gi|114330836|ref|YP_747058.1| glutaredoxin-like protein [Nitrosomonas eutropha C91]
    MDIADSIEQQVSTHPVVLYMKGTPQQPQCGFSANAVQILSACGVEDFFAVNVLADPEIRQGIKDYSSWPTIPQLYVNGEF
    VGGSDIMAEMFQNGELKKLLEK

    >gi|114330851|ref|YP_747073.1| redoxin domain-containing protein [Nitrosomonas eutropha C91]
    MSKPNKFSFYIIVAILSLAAGIAYKSREMGITTSLSDNAKKTAAETFFNTTLSTPEGIPQAMSQWRGKIIVINFWATWCL
    P
    CRDEIPELIDTYATYHQKDLVIVGIAIDNAEKVAAFSKEFNINYPVLVGEFDAFTLTEAMGNPQGALPFTVTIDRNGTI
    VDTHLGRIKKQQIEAIIQPML

    >gi|114330852|ref|YP_747074.1| protein-disulfide reductase [Nitrosomonas eutropha C91]
    MRWIKFILILLSLCLISTHTMAEESRSGGLMSILQRLGMSIDQTEQELLPPDEAFKLSLEVRDDHTLIARLTPARDYYLY
    RDKIAFESKSEGIHIEQVTLPSGKMKNDQLFGNTEVYYQPLEAVITLRRESSAPEQLSLSATYQGCNEPIGVCYAPINKE
    NELLLPALKAIVNTAAGAISNNVQAANADSTAELFQSPGNTAPLFETESYKIERLFASGNFWLILSGFFGIGVLLAFTPC
    IFPMLPILSGIIASKGQQMSKTHGFILALAYVLGMSITYAAAGAAAGLSGAMLSASLQNAWVLGTFALIFTALALSMFGF
    YELQMPAFIQNKLIEEANHFKGGQLAGVFGMGALSALIVSPCVAAPLAGALIYISQTRDVVLGGSALFVMALGMGVPLLL
    LGVSAGALLPKAGAWMKSIQQFFGVLLLAVAIWLISPVITEVVHMLLWAALLIISAIYLHALDPLPHQASGFSKFLKGIG
    VIALLTGVALLIGVLSGSRDILQPLSKFNLTASTSSAQLAESPAGMNAPLPFKQIKTAAELDELIRQSRGHYVMIDFYAD
    W
    CISCKEMERFTFTDPQVQARLKNVELVQINVTEGTPDDAELLKRFKLFGPPGILFFDKQGVEIPDIKIIGYLDKKDFVT
    VLDAILL

    >gi|114330919|ref|YP_747141.1| UBA/THIF-type NAD/FAD binding protein [Nitrosomonas eutropha C91]
    MDDQQLLRYSRHILLPEIDFSGQTKLIQSSVFILGAGGLGSPSALYLAASGIGRLVICDHDRVDLTNLQRQILHDTASVG
    ELKTDSARNTLQRINPEIEIIPLARHATVDLLNREISGVDVVIDASDNFSARHILNQACLDHRKPLISGAAVRFTGQVAA
    FDLRQSDSPCYHCLFPDSGDSDDPG
    CAVMGVFSPLTGIIGCIQAAEAIKVLLEIGETLHGRLLLLDGLAMRLRSFKLKKD
    PQCPACGSASAKK

    >gi|114330994|ref|YP_747216.1| glutathione peroxidase [Nitrosomonas eutropha C91]
    MDIYDYGIKTIDGQNKLLSDYKGKVLLIVNTASKCGFTPQYQSLEALYRRYKDQGLVVLAFPCNQFGRQEPGNEREIQEF
    CSSGYNISFPLFAKIEVNGTNTHPLYQYLKNEKPGVLGSKGIKWNFTKFLVDRTGKVVKRYAPVDKPESLVGDIEQLL

    >gi|114331006|ref|YP_747228.1| putative inner membrane protein [Nitrosomonas eutropha C91]
    MSWYNFKYQYLVRFWLPVPAVIAAGILSAFYFGVTGTFWAVTGEFTRWGGHILQWLGLDVSHWGYFQVIGLQGSPLTRID
    GVMILGMFAGCFSAALWANNVKLRLPQHRIRVFQAIVGGIIAGFGARLAMG
    CNLAAFFTGIPQFSLHAWFFAIATAIGSL
    AGAKVSLLPVFRIPVQLQKVSAAQPLNQHATRERQHFCIGMLLFIAFVLWAASKALDEPKLGYAALFGLAFGLIIERAQV
    CFTSAFRDLWITGRTQMAKAIIAGMAVGTIGVYSYVQLGMDSKIFWAGPNAVIGGLLFGFGIVLAGGCETGWMYRAVEGQ
    VHFWLVGLGNIIGSTLLALVWDDLAPLLVVNFDKINLLKTFGPQGGLLATYIMLGVFLALVLYWEKYFFARKARQASQTA


    >gi|114331049|ref|YP_747271.1| redoxin domain-containing protein [Nitrosomonas eutropha C91]
    MASLETPVCDFGWKAIDFDLPGVDGKRYNLASVLGENGLLVMFICNHCPYVKAVRDRIIRDVKELAGHGIGTIAIMSNDP
    ADYPEDSFESMGKIAREYAYPFPYVMDETQETAKAYGAVCTPDFFGFNNKLELQYRGRLDASRKEAAPADARRDLFEAMV
    QVAKTGSGPEEQISSIGCSIKWRAD

    >gi|114331111|ref|YP_747333.1| glutathione S-transferase domain-containing protein [Nitrosomonas eutropha C91]
    MMTLYSTATCPFSHRCRIVLHEKDMDFQVIDVDPNNIPEDIAVISSHGKVPILVERDLVLYEANIINEYIDDRFPHPQLM
    PAEPVMRARARLLLHRFEKELFSHVESLEQGNPKAADKIRIEIANGLAMIAPIFDKQRYMLGDEYTMLDVAIAPLLWRLD
    HYGIKLPKQAAALLKYAERLFSRPLFIDALTPAEKLMRK

    >gi|114331173|ref|YP_747395.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Nitrosomonas eutropha C91]
    MSSDTTENMGFDLTQGITLADFGDQQLLRGQVGDESIILVRTGNEIMAIGAHCTHYGGPLEEGLVVVGATIRCPWHHACF
    SLRSGEALGAPAFDPLPCWKVERDGERIFVRNIISPAPQPEPIIAAADQPKNIVIVGGGAAGFACAEMLRRRGYQGRLTI
    LSEDTDAP
    CDRPNLSKDYLAGTAPEEWMPLRPDGFYKDNHIDLQLGTIVQHIDTANHQITTKDDRSISFDRLVLATGAEP
    IRLPIPGQDGAHVFTLRSFSDSRRIIEYAKNARTVVVLGSGFIGLEVAAALRARGLAVHVVSLDQSPLQNVLGSELGNFI
    RSLHEAHGVTFHTETSLTTIEPESVTLSNGDKLTAELVILGVGVRPRTTLAELAGLNVDKGILVDEYLQTNVPEIYAAGD
    VARWRDKASGLALRIEHWVVAERQGQVAAENLLGANKKFQDVPFFWSVHYDLTINYAGHAQSWDAIEIDGDIAARDCLVR
    YQKNGVTIAVAGIGRDKQILEFAAANA

    >gi|114331218|ref|YP_747440.1| methylated-DNA--protein-cysteine methyltransferase [Nitrosomonas eutropha C91]
    MNYYIIMESPIDPLLLTSDGEFLTGLYMEKEAQKLLSGMKDGWLQNTDAIPFKEAIAQLNAYFSGELHEFDLPLKATGTP
    FQEMVWQALTSIPYGKTVSYKDIAEHVHLPRAARAVGMANGRNPISIIIP
    CHRVIGANGKLTGYGGGIHRKEWLLEHEHK
    DKQTTLI

    >gi|114331238|ref|YP_747460.1| iron-sulfur cluster assembly accessory protein [Nitrosomonas eutropha C91]
    MAITLTERAARQIQHQLGKRGRGVALRLGIRKSGCSGFAYSFDYADDVLEDDQLFESNDAKVIVKRDQVSFIDGSEIDFV
    QDGLNSSFKFSNPNIDNTCGCGESFSLKT

    >gi|114331241|ref|YP_747463.1| redoxin domain-containing protein [Nitrosomonas eutropha C91]
    MKQQWGIIALLTLILCLSVKGVEAYDFHFEDSAGKTHTLSDYKGKWVLVNFWATWCPPCLKEIPDLSRLSQERNDIVIIG
    IAMEYDNTKDVMQFVKKMAISYPIVLGDRAAAAQIGDDISMLPSTYLFDPDGKPAARKIGLITRAEIETFIDAR

    >gi|114331284|ref|YP_747506.1| heavy metal translocating P-type ATPase [Nitrosomonas eutropha C91]
    MGASNDNQAQAGATMISLPIEGMTCASCVGRVEAALAKVEGVSDVSVNLATERADIHLANSVDRMALIQAVEKVGFDVPA
    TIIELVVEGMT
    CASCVGRIERALKAVPGVQEATVNLATEHATVHGVADADTLINAIVNTGFTAKAMDTTAQASDEATEKK
    DVERALLKRDLILASALTLPVFVIEMGSHLIPAVHDWVMATIGIQQSWYLQFALTVLVMIFPGRRFYEKGFPALLRLAPD
    MNSLVAVGTVAAFGYSVIATFAPDLLPAGAVNVYYEAAVVIVTLILLGRFLEARAKGRTSEAIRRLVGLQVKVAHVLRDG
    NIVDIPIGEVTLDDSVEVRPGERIPVDGEVVEGRSFVDESMITGEPVPVEKTVGSEVVGGTVNQRGAFILRATAVGGQTM
    LAQIIRLVEQAQGSKLPIQAMVDKVTLWFVPAVMLAAVITFLIWLIFGPAPALTFALVNAVAVLIIACPCAMGLATPTSI
    MVGIGRGAEMGILFRKGEALQLLKDARVVAVDKTGTLTEGRPALTDLEVAPGFDRNQVLTQVAAVESRSEHPIARAIVEA
    AAQEGITLPAVTEFESVTGKGVCATVEGISVKVGSDRYMRELGIDVTGFAKTAERLGNEGKTPLYTAVDGQLASIVAVAD
    PIKSSTPAAISALHQLGLKVAMITGDNARTAQAIARQLGIDDVVAEVLPEGKVEVVRRLKATYGRVAFIGDGINDAPALA
    EADVGLAIGTGTDIAMESADVVLMSGNLQAVPNAIALSKATITNIRQNLFWAFAYNTALIPLAAGALYPALGLLLSPIFA
    AGAMAMSSVFVLGNALRLRRFQPPSLIAS

    >gi|114331299|ref|YP_747521.1| putative mercuric transport protein [Nitrosomonas eutropha C91]
    MSEPQNGRGALFAGGLAAILASACCLGPLVLIALGFSGAWIGNLTVLEPYRPIFIGAALVALFFAWRRIYRPAQACKPGE
    VCAIPQVRATYKLIFWIVAALVLVALGFPYVMPFFY

    >gi|114331300|ref|YP_747522.1| mercuric transport protein periplasmic component [Nitrosomonas eutropha C91]
    MKKLFAALALAAVVAPVWAATQTVTLSVPGMTCSTCPITVKKAISKVEGVSKIDVTFETREAVVTFDDAKTSVQKLTKAT
    GDAGYPSSVKQ

    >gi|114331302|ref|YP_747524.1| putative mercuric reductase [Nitrosomonas eutropha C91]
    MYLNITGMTCDSCATHVKDALEKVPGVLSALVSYPKGSAQLATDPGTSPEALTAAVAGLGYKATPADAPSTSARGRLLGK
    ALGWLGGGDKAGGDGDGLHVAVIGSGGAAMAAALKAVEQGANVTLIERGTIGGT
    CVNVGCVPSKIMIRAAHIAHLRRESP
    FDSGIAATVPAIDRSKLLAQQQARVDELRHAKYEGILDSNPAITVLHGEARFKDDQSLAVRLNDGGERVVAFDRCLVATG
    ASPAVPPIPGLKESPYWTSTEALVSDTIPERLAVIGSSVVALELAQAFARLGSKVTILARSTLFFREDPAIGEAVTAAFR
    AEGIKVLEHTQASQVAHVDGEFVLTTGYGEIRADQLLVATGRAPNTRSLALEAAGVAANAQGAIVIDKGMRTSTPHIYAA
    GDCTDQPQFVYVAAAAGTRAAINMTGGDAALDLTAMPAVVFTDPQVATVGYSEAEAHHDGIETDSRTLTLDNVPRALANF
    DTRGFIKLVIEEGSGRLIGVQAVAPEAGELIQTAVLAIRNRMTVQELADQLFPYLTMVEGLKLAAQTFSKDVKQLSC
    CAG


    >gi|114331339|ref|YP_747561.1| transcriptional regulator, AraC family protein [Nitrosomonas eutropha C91]
    MMIDQAQTHYDRIVKAIEYIQENFKQQPALEDIAAAVHLSPFYFQRLFSEWAGVSPKKFVQYLSLEYAKSLLKNRNSSLM
    EAAYETGLSGASRLHDLFVNIECMTPGEFKNGGKALRIDYCFADSPFGKVMIASTSKGVCRIAFEEDEVLAFSNLNKSFP
    NASYTQRVNQSHQAALFIFQKDWSRLDEIKLHLNGTPFQLKVWECLLKIPMGDLTTYGHIAKTIGNPKASRAVGTAISRN
    PVAFLIP
    CHRVIQSSGQIGGYMWGATRKSAMISWEAARTGA

    >gi|114331343|ref|YP_747565.1| glutaredoxin [Nitrosomonas eutropha C91]
    MRLVFKLIRIILTPFMLIAEKLTTPKGINRDSEAQAQVDADCSQLALYEFKACPFCIRVRKEMARLSLNVVKYDALDNPT
    HRQALKAGGGRIKVPCLRISHDNGEVQWLYESNDIIAYLQQRFAAE

    >gi|114331415|ref|YP_747637.1| OsmC family protein [Nitrosomonas eutropha C91]
    MKVKIAWQEGVSFLGQVGSGHSVLMDGAPEAGGKNQGPRPMEMILLGLGGCTSFDVVHILRKGRQEITGCQVEVDAQRAT
    EDPKVFTHIHLHFIIAGRNLDLRQVERSISLSAEKYCSASMMLKATVNITHDYEVIAG

    >gi|114331501|ref|YP_747723.1| disulphide bond formation protein DsbB [Nitrosomonas eutropha C91]
    MRIIFLLIFLACAGLIGYALYLQLMDGLLPCPLCIFQRIAYWLIGITALFTFIHNPQSLGQHIYYGLIILFSLAGAIVAG
    RQAWLIRFPEAFE
    CGISPEEAFLNGLPLAQWWPNMFEANGDCNDGTWQFLSLTLPDWSLLIFAAFGIIAGLLWHKKYNSI
    NQ

    >gi|114331529|ref|YP_747751.1| iron-sulfur cluster insertion protein ErpA [Nitrosomonas eutropha C91]
    MNTITHEEANTVQPPLFFTDSAASKVKELIEEEANQALKLRVFVSGGGCSGFQYGFTFDEIINEDDFVIEKQGVRLLVDS
    MSVQYLLGAEIDYQENAQGAQFVIKNPAAASTCGCGSSFSV

    >gi|114331589|ref|YP_747811.1| DSBA oxidoreductase [Nitrosomonas eutropha C91]
    MNVKKIICFLLGFVAINLAGILTVHAEIIEGKDYKVLSTPQLTETESQQIEVIEFFWYGCPHCSDLNPYLGRWLESKPAD
    VEFRYVPAIFRNNWAPAARLFYAIESLGLGEILHDKIYHAVHHEKTDLSKEETLFNWIEQQGVERDKFIGAYNSFTVQNQ
    ANRAAQITRQYQLTGVPALVIDGKYLTSGKAGGLPQDTISVLNQLIEKVREERKTRQ

    >gi|114331618|ref|YP_747840.1| dihydrolipoamide dehydrogenase [Nitrosomonas eutropha C91]
    MHKFDVIIIGAGSAGLSALREVRKRTDNFVLINDGPWGTTCARVGCMPSKLLIEAANAFHRRFNFGEFGIMGADQLELDG
    KKVLQRLRRLRDDFVTSTLKITNDLGERAISGRARILSPDQVMVNGEKLSAHKIIIATGSRPVVPKNWLNLGKRLLTTDT
    LFELDTLPKSIAVIGMGPVGLEMIQALSRLGVHVTGFGFRSSVGGISDPFINQTAVKLLSEEFPLYLGSKASVAINPDNN
    VLTVRAENIEIEVDSVLAALGRQPNIDDIGLDTLDVPLDEKGLPSVNPITLQIADLPVFLAGDANQRLPLLHEAADDGHI
    AGLNTTSEELIYFKRRVPLAIVFADPNIAVVGQSFHSLEHENIQIGEVSFSNQGRARSAQSNRGALRVYAAANDGRLLGA
    EMCAPAGEHFAHLLALAIDQSLSVWDLLRIPFYHPVLEEGLRTALRNLASKLPACSKSDLAACDSFNSEALD

    >gi|114331620|ref|YP_747842.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nitrosomonas eutropha C91]
    MPVDLIPDFELASTGNKQFRLSGIKSKYLVIFFYPKDDTPGCTNEGQQFRDLYPEFVQEGCEIVGISRDSLKSHEKFREK
    YNFPYNLLSDADEVVCELFGVIKMKNMYGKQVRGIERSTFILDREGKLYKAWRGVKVPGHAEEVLAFIKKI

    >gi|114331623|ref|YP_747845.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Nitrosomonas eutropha C91]
    MMRFLLPLAIFVILVIFLGIGLTLNPRQVPSPLIDKPAPIFHLQQLYDSSKTLSSEDNLGKVWMLNVWASWCVACRDEHP
    VLVELSKLGIVPIYGLNYKDQRDTAMQWLRQYGNPYETSIVDADGKVGIDYGVYGVPETYVIDKQGIIRYKHIGPVTVES
    LKDKILPLIKELKS

    >gi|114331639|ref|YP_747861.1| selenide, water dikinase [Nitrosomonas eutropha C91]
    MHPEKIALTQTVQKGGCAAKVAATTLHRILQQVRFPAAHSALMVDGRYFDDAAIYKINEQTALVQTLDFFTPIVDTPRLF
    GEIAAANAISDVYAMGGRPVTAMGILAFPLATLSEHIIVDVLQGASDKIAEAGANFVGGHSIDDDTLKFGLSVTGLVNPQ
    QVWTNANAQSGDHLVLTKALGTGTLTAGIKRQQLQEKDIMDALESMAAINNVIDYLSPDLLAAIHAATDITGFGFSGHAM
    QLANASNVTLSIATGNLPRFDKAFYCLKNSFLTKAHRTNAEYTTPHIDDAKLDALYKLLIHDPQTSGGLLLSVVPEASQL
    VLQALRTYFKPAAIVGTVHPRQDKAVQFE

    >gi|114331672|ref|YP_747894.1| putative thiol:disulphide interchange protein [Nitrosomonas eutropha C91]
    MRLFLYSFGLLGLLFTGIAQANEADLKEAIQAHFPGSKIESLTQTPYLGLYEAVIDGEIFYTDEKAEYFFMGHIVDAKKR
    ASLTSERMQQIRDSRRIAIDTLPLEHALKMVKGNGKRTLIVYSDPN
    CPYCKRLEKELVNVTDITIYTLLYPVLNGSMTTA
    EAIWCSEDRVKAWDDFMLKSVVPTGKNCDAPLQILLESGRQNRVTGTPTLIFADGSVVPGFIPQSEIEKRLDQATSK

    >gi|114331750|ref|YP_747972.1| dihydrolipoamide dehydrogenase [Nitrosomonas eutropha C91]
    MNNIFDVAVIGAGPGGYVAAIRCAQLGLNTVCIDDWKNEQGRPSLGGTCLNVGCIPSKALLESSENFARAGHKFAEHGIK
    LDGLSIDVPAMIARKDKIVKAFTGGIGMLFKKNKVTVLHGRGVLQKRDNDDDSWEIRVKTDEKEQSVRTRHVIIATGSVP
    RSLTIAPVDGVNVLDNAGALALQQTPGKLAIIGAGVIGLELGSVWRRLGAEVTILEAQADFLSAADEQVAKEAYKALTRE
    TGLVIHTGVEIKSTQAGKDNVKIEYTDRDKNVQSLEVDKLIVAVGRVPNTASLGAKETGLQLDERGYIGVDKFCQTSLQN
    VYAIGDVVRGPMLAHKASEEGVAVAERIASNQQGASDSTAHIDLGMMPWVIYTAPEIAWVGKTEQALKAEGVIYKVGQFP
    FMANGRARALGETTGFVKVLADAESDRILGVHMVGPYVSEIIAEAVVAMGFSASSEDLARIVHAHPSLSESLHEAALGVA
    KRTIHI

    >gi|114331759|ref|YP_747981.1| glutaredoxin 2 [Nitrosomonas eutropha C91]
    MNNRAELRKLIVYGREGCHLCEDMIASLGDLQKEFRFEFVVINIDKDENLTRLYNERVPVLFAVKEKKELCHYFLDLEAF
    NAYLA

    >gi|114332068|ref|YP_748290.1| dihydrolipoamide dehydrogenase [Nitrosomonas eutropha C91]
    MTQFTTIVLPDIGDFKDVPVIETLVKPGDRVEQEMPLLVLETDKASIEVPAPQSGIVKEMHVKAGDKISQGSLIATLEVK
    DAEAVPSASSYDETKVTDQPVVAGAGKVPSRIVVPSPETARGKLRAEVVVLGAGPGGYTAAFRAADLGKQVVLIERYSTL
    GGV
    CLNVGCIPSKALLHAAKTLTEAKEADQYGIHFGRPEIDIGKLCSWKESVVGKLTKGLSMLAKQRKVTVIHGAGKFAN
    SHLIEVETSDGIETVSFEHCIIAAGSSAARIPILPDNECIIDSTGALALTEIPPRMLIVGGGVIGLEMATVYHALGSKIS
    IVEQMVQLIPGADADLVKPLHKRLKAGCEAIYLNTSVSRIEVDGKEVQVFFEGEQAPEPQRYDRVLVAVGRRPNGKLINA
    EAAGVSVDEHGFITVDKQMRTNIAHIFAIGDIVGDPMLAHKASHEGKIAAEVIAGHKVAFDARTIPSVAYTDPEVAWMGL
    TETEAEKQGIAYEKAVFPWAASGRAITLARDEGMTKLLFDKTTRRILGAGIVGAHAGELISETVLALEMGADMQDIGLTI
    HPHPTLSETVLFSAELAEGTITDLYVPKK

    >gi|114332144|ref|YP_748366.1| hypothetical protein Neut_2179 [Nitrosomonas eutropha C91]
    MKKNTTVEKIKAPELITSGWLNASEPITLASLRGKVVLMHAFQMLCPGCVQQGIPQAQQVFNEFDPERVAVIGLHTVFEH
    HEVMGRDALEVFAYEYRLRFPIGIDKPNEQHSIPHTMMTYHMQGTPTTILVDKTGHLRLHKFGHVSDFLLGVSIGTLLAE
    EVSDKELAAASAADQSGDTQPGCDDEGCRV

    >gi|114332167|ref|YP_748389.1| hypothetical protein Neut_2204 [Nitrosomonas eutropha C91]
    MIKRLTQETPPIIATLDDLAKLANYSFMDSLNCDPDAEVNGRNHTPRQVFTGHYVPVNPTPIEDPEYVAHSKNFFRELGF
    ANSMATSADFVRVFSGDLAHVPEPMRKVGWACGYALSIFGTEYYQQCPFQTGNGYGDGRAISVLEAVINGQRWEMQLKGG
    GRTPYCRGADGRAVLRSSVREFLAQEHMHALGVPTSRSLSLYVSKTEKVRRPWYSEGSHSQDPDMLVSEAVAISTRVASS
    FIRVGQLELFGRRARKMEHPRAMEELEKIVLHLIDREYDNVIDQKLATTEKVVLLAREFLNRLTSLVANWIRVGYCQGNF
    NSDNCAAGGFTLDYGPFGFCDVFNPHYQPWTGGGRHYSFLNQPVAAERNFHMFCSALRPLLMAHQDCLAQLDEIQSDFPK
    VMQAQMEKMWAAKLGLGTFHATLFSELVTLMLQTSVDYTMFFRELSMVPDDIGLLKKSFYKNSTYHADSEGMDKRWSAWL
    TKWKSLTQSCSREELSRQMKRVNPKYSLREWFVVPAYQQAATGDYSLIQELQEVMTQPYAEQSKDVDEKYYRLKPLELFG
    VGGSSHLS
    CSS

    >gi|114332323|ref|YP_748545.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nitrosomonas eutropha C91]
    MSLINTTIKPFKATAYHNGDFVEVSDKTLKGKWSVIVFYPADFTFVCPTELEDLADNYAEFQKAGIEVYSVSTDTHFTHK
    AWHDSSSVVRKVQYPMIGDPTRQLARDFDVLIEEEGLALRGSFIINPEGQIKALEVQDLSIGRNAAELLRKAKAAQYVST
    HSGEVCPAKWTDGAATLKPSIDLVGKI

    >gi|114332429|ref|YP_748651.1| thioredoxin [Nitrosomonas eutropha C91]
    MSQHIHYVTDATFEAEVLQCPLPVLVDYWAEWCGPCRMIAPILDEIANEYNGRLKVAKLNIDENQSTPQKYGIRGIPTLM
    LFKNGNIEATKVGALSKSQLIAFVDDHL

    >gi|114332241|ref|YP_748463.1| thioredoxin [Nitrosomonas eutropha C91]
    MASKAIFYHAGCPVCVSAEQAVANAIDPSKYTVENVHLGTDKSRIGEAEAAGVKSVPALVIDGAAFHINFGAGIDDLK