Arthrobacter aurescens TC1 uid58109

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|119962805|ref|YP_945852.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Arthrobacter aurescens TC1]
    MASLHARLESDAQLTHTLDIAYRIVDSPLGKLLLAATDRGIIRVAFEVEDHQSVLQLLANTVSPRILEAPARLDDAAREL
    DEYFTGARKEFDLTLDFRLSRGFRLNVLRHLPRIPYGNTASYAQVAQAAGSPNAVRAVGTACATNPLPLIVP
    CHRVVKSD
    GSFGGYLGGSEAKRALLRLEAAA

    >gi|119961722|ref|YP_945854.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Arthrobacter aurescens TC1]
    MSSRHTTLDSPLGQLTLTARGEVLTGIFYDGHWHMPPPDYFGDPAGIEDPVFARTRTELAEYLDGHRTVFDVPFQALGNP
    FQEKVWERLQHIPFGETVSYGQLAAEFGDPHLAQAVGSAVGRNPISIIIP
    CHRVVGRNGQLTGYAGGLRNKRFLLELEEP
    AEVREGKLF

    >gi|119963914|ref|YP_945892.1| putative glutathione s-transferase [Arthrobacter aurescens TC1]
    MSDKTISEEHSTRGAYVTGNEFNRDTNYIEDRITRDGASGPNGEPGWPVEPGRYRLIAARACPWANRTVIVRRLLGLEDV
    ISLGQPGPTHDARSWTFDVDPEGKDPVLGIERLQEAYFRRFPDYPRGITVPAVVDIASGAVVTNNFPQITLDFSTEWTEF
    HRPGAPQLYPEHLREEIDQVNKRVFTEVNNGVYRCGFAGSQEAYDAAYTRLWNALDWLEERLTGQRYLVGDSITEADVRL
    FTTLARFDAVYHGHFKCNRNKLSEMPALWGYARDLFQTPGFGDTTDFVQIKQHYYIVHEDINPTQIVPAGPDLSGWLTPH
    GRESLGGSPFGEGTPPGPVKVGEEVAAGHGAG

    >gi|119962407|ref|YP_945929.1| putative rhodanese-related sulfurtransferase [Arthrobacter aurescens TC1]
    MSDFDTVPVGDIPADASILDVREDYEWVAGHAEGARHIPMDQLPARLEELDPDDDLFVICRTGGRSFRAVQWLVGQGYSA
    VNVAGGMDMWFEAGKPMVSDNGLKPVVL

    >gi|119960656|ref|YP_946479.1| glutathione peroxidase [Arthrobacter aurescens TC1]
    MTSLYSIPLTFNDGTEADFGRFEGKAVLVVNVASECGYTRQYAGLEELYGKYRAQGLEILGVPCNQFGGQEPGADDVIAE
    FCERNFGVTFPLTSKANVLGKQQHPLFAELTRDEDGQSAKVKWNFEKFVINRGGELVARFPSAVEPDSEDLMEAVEKALL


    >gi|119962002|ref|YP_946492.1| DSBA-like thioredoxin domain-containing protein [Arthrobacter aurescens TC1]
    MKIEIWSDVACPWCYIGKRRFETALAQFPHRDSVDIEWKSYQLDPSVPEHYDGTELDYLSNRKGMAPEQVKQMFAHVTET
    AKGEGLDYHFDKVVVANSFTAHRLIHLAASHGRQDAAKEQLLSDHFEHGKDIGNQEYLTELGASLQLPADEVAELFTSDK
    YTDAVNQDINEARAIGVTGVPFFVIDRKYGISGAQPADLFSQALNQAWQEANPLIPVGASDAEACGPDGCAV

    >gi|119962564|ref|YP_946619.1| pyridine nucleotide-disulphide oxidoreductase domain-containing protein [Arthrobacter aurescens TC1]
    MTAESSREFDVIVIGAGAVGENVADRVVRGGLTAVIIESELVGGECSYWACIPSKALLRPGSVLHAAQVVPGAKEAITGT
    MDAEAALKHRDWFTNNWQDGSQVEWLDSAGIELIRGRGRITGPREVQVDGLDGNNYALKAHHAVVVATGSTPTIPDIDGL
    KDVPFWTTRGATAAKEIPKRFVVLGGGVAGVELAQAFARFGSDVTLIARGRLLSSYTEEAANLVLAGLRADGVAVHLHTD
    VEKVEKNDDGSLTVTFDDKTITADKLLVASGRHPALVNLGLENVGVEAQDGKPLRLTTDASGLVEGPASDGTSGLWLYAA
    GDAAGKVLLTHQGKYEARATGDAIVARANGKLTGTPKPWSPWAHTANDHAIPSVVFTDPEVASVGASLEQALLQGKNVTG
    VELPIDVSGSQLHSPDYKGWAQIVVDEDRKVILGATFVGPGVAELLHSATIAIVGEVPLDRLWHAVPSYPTVSEVWLRLL
    EKYGL

    >gi|119963108|ref|YP_946620.1| putative thiosulfate sulfurtransferase [Arthrobacter aurescens TC1]
    MGDELKPFVDWNWCARNLGTVVFVDARWYLDGSSGKDAYDAGHLPDAVFVDMDRWLSGPATPEAGRNPLPEPEVFAQGMR
    EAGIGDSDTVVAYDDAGGVIAARLVWMLRSTGHTAAILDGGIGNYPGDLSTETPLRRTGSFTAKAWPADLLADISEASSD
    TFLAVDARNRDRFEGRQDPIDPRPGHIPGAANVPCRENLDSTGNLLPEPQIRTNFERAGVLSAEGTIAY
    CGSGVTACHNL
    LVMEQLGMGSGRLFVGGWSQYSRANDRPVETKI

    >gi|119963472|ref|YP_946769.1| pyridine nucleotide-disulphide oxidoreductase domain-containing protein [Arthrobacter aurescens TC1]
    MSQESVDNRMGAEYDVVVVGGGAAGLSAAVTLGRALRSILVIDAGEPRNAPAAGVHGFLSRDGINPKELLALGRAEANQY
    GAAIVEGVAVTARSTTGLTEGSVLAFEVDLADGQTARARRLLVTTGLVDLLPDVQGLGERWGKDVLH
    CPYCHGWEVRRKQ
    IGIIGSGPMALHQAMLFRQWSSDITLFLNDVVEPTDEQWEQLAARSITVVDGRVQALEVTHDVLTGVVLASGTVIPVEAV
    VTGSRMEARSGVLESLGVPSVEHPMGVGSHVEVNPMGGATSVPGVYAAGNVTDLMGQVVASAAAGVMAGAAINADLIAEE
    TRLAVEAARSSTVSR

    >gi|119964523|ref|YP_947035.1| organic hydroperoxide resistance protein [Arthrobacter aurescens TC1]
    MKTLYIAEALASGEGRDGNARTNDGKLDVALASPVELGGNGEGTNPEQLFAAGYAACFHSALRLVGRKERVDLSDSAVAA
    KIHFGALTDSEGYGLAAELEIALPALDRGTAEQLMAKAHQI
    CPYSNATRGNMAVDLKLVEFAA

    >gi|119964033|ref|YP_947072.1| hypothetical protein AAur_1289 [Arthrobacter aurescens TC1]
    MAMAALGPAETGGPAETGGPAETGGPDWPGASNALGSEPSAYLRQHADNPVFWRPFGDEAFSFAAERDVPVFLSIGYAAC
    HWCHVMAHESFEDQETADYLNAHFVPVKVDREERPDVDSVYMAATQAISGEGGWPMSVFLTPDGLAFHAGTYFPPVPLPG
    RPSFRNVLEAVHEAWVERRDAVEQNARGLAANMAGAQLGGAVRFDGPPEVLDANVLPEAVALLARSEDPDAGGFGSAPKF
    PPSAVLEFLIRHAAAPSDTADEARDMAARALAGMARSALRDQLDGGFARYSVTADWSVPHFEKMLYDNAQLLRLYAHWVR
    LGGNEVFTAGEAASVASRCAEWMVDSLKLPNGALASSLDADTVVGGVHHEGATYLWTPESLREALGPRDAEAVADMMNVG
    ARGTVSELGSPLHPARTLTDAESRLWQRVRPVLLASRNLRNQPARDEKVVAGWNGLAVAALAEAGAILDRPDLVAAAEAV
    AEYLADVHWDSSSQVLVRVSHDSRARGIGGLLEDYAFCTEGFLALYAVTGTKRWYRLAEELILAACSRFVENGHLADSAG
    ESAQVFNAQGQHAALDPFDNATPSGAAGFAGALLTYAAYSGSHQHRLMAGNILGLLPPLATRAPRVAGWLLATAQAALAG
    PVEAAVAGYDSPLRRELHSALLKSPSPGLVVALQSDDGGSPAGEAEVPLLLHRSGAPDGSPQVYLCRDMVCERPLGDVAA
    VQARLAAMALGAS

    >gi|119961092|ref|YP_947512.1| putative osmotically inducible protein (OsmC) [Arthrobacter aurescens TC1]
    MAATRTAHTVWNGNLIEGAGNTTLDSSGLGTFDVTWKARTEQSGGKTSPEELIAAAHSACFSMAFSHALAGEGFTAEEVQ
    TKADVTFVPGTGITGSHLTMTAKVPGLSEEDFRRISEDAKTG
    CPVSGALASIEITLDATLTV

    >gi|119964061|ref|YP_947516.1| dihydrolipoamide dehydrogenase [Arthrobacter aurescens TC1]
    MGRWFAKVNSIVTNARELRCWHNHGRTSSKDQMARSPVSSFTRGSVLVADQATAQEFDILVLGGGSGGYATALRAVQLGF
    TVGLVEKAKLGGT
    CLHNGCIPTKALLHSAELADHARDSAKYGVNVTLDSIDMSAVNAYKDGIIAGKFKGLQGLIKSKGIT
    VIEGEGKLQGNNTVVVNGTSYTGKNIVLATGSYSRSLPGLEIGGKVITSDQALTMDYIPKSAIVLGGGVIGVEFASVWKS
    FGVDVTIIEGLPSLVPNEDASIVKNLERAFKKRGIKFTTGIFFQGVEQNDDGVKVTLVDGQTFEADLLLVAVGRGPVTAN
    LGYEEAGITIDRGFVITNERLHTGVGNIYAVGDIVPGVQLAHRGYQQGIFVAEEIAGLNPAIVEDINIPKVTYCEPEIAT
    VGYTEKAAKEKFGDDQVQTQEYNLAGNGKSSILGTGGIVKLVRQKDGPVVGIHMIGSRMGEQIGEAQLIVNWEAYPEDVA
    QLVHAHPTQNESLGEAHLALAGKALHG

    >gi|119963529|ref|YP_947561.1| methionine-R-sulfoxide reductase [Arthrobacter aurescens TC1]
    MLRQAGTERPYTGEYWDTHTEGVYQCRACGSQLFTSREKFDSHCGWPSFWAPLAEGTVRYLHDRTMGMDRVEVRCANCDS
    HLGHVFEGEGYGTPTDQRF
    CINSVSLRLVKPEES

    >gi|119962607|ref|YP_947566.1| thiosulfate sulfurtransferase [Arthrobacter aurescens TC1]
    MSYPVEQNEKFASYANPERLVSTEWLAAALADGAIADGKLVVVESDEDVLLYETGHIPGAVKIDWHTDLNDEVTRDYVDG
    AAFAALAASKGISRDSTVVIYGDKSNWWAAYALWVFTLFGHEDVRLLDGGRDKWIAEGRELTTDVPRPAVGEYPEVERND
    APIRAFKEDVLAHLGNPLIDVRSPEEYTGQRTHMPAYPEEGALRGGHIPTAASVPWARAAAEDGTYRSREELEALYLGEA
    GLERGDDVVAY
    CRIGERSSHTWFALKYLLGFDTVRNYDGSWTEWGNAVRVPIVKGAERGSVPASLVSN

    >gi|119960660|ref|YP_947601.1| thioredoxin [Arthrobacter aurescens TC1]
    MNKAIIKCPHCGKSNRVPAAADGRPRCGNCHHDLPWVVEAGDDDFSAIAERPGVPVLVDFWAVWCGPCRVVSPVLDKLAY
    ERAGQIKLVKVDVDHSPQLSARFAIQAVPTLMVIVDGKIVARQAGAAPAPVLRSWLEEALTK

    >gi|119963465|ref|YP_947630.1| thioredoxin [Arthrobacter aurescens TC1]
    MNKAIIKCPHCGKSNRVPAAADGRPRCGNCHHDLPWVVEAGDDDFSAIAERAGVPVLVDFWAVWCGPCRMVSPVLDQLAH
    ERAGQIKLVKVDVDHSPQLSARFAIQAVPTLMVIVDGKIVARQAGAAPAPVLRSWLEEALTK

    >gi|119960900|ref|YP_947687.1| mycothione/glutathione reductase [Arthrobacter aurescens TC1]
    MRTTSMHTTAGKTTVDRHYDLIIIGTGSGNSIPGPEFEDQSIAIIEEGSFGGTCLNAGCIPSKMYVYTADTALQTVESGR
    LGLHAEVNSVDWPGIVSRIFEDRIDPDSAAGEEYRRGPRTPNIDVYDQHAVFVGERTLRTGQGSQQRTISGDRIVIAAGS
    RPAVPDVISASGVRYHTNEDIMRLPQLPKSLVIIGGGYIAMEFAHVFDALGTDVTIIARSTLLRHLDEDLLDPYNNLAAK
    RFDIRSGRTTTSAEQTDRGITVTLDDGSSATGEVLLVATGRIPNGDLLDLPSGGIETIGAGRIKVDEYGRSTSAAGVWAL
    GDVSSPYMLKHVANAEMRAVRHNLLNPDNMQKMPHDHVPAAIFTHPQIATVGMTESQARERGHNVTTKVQSYGDVAYGWA
    MEDTTSICKLIADQDTGKLLGAHYMGPQASTLVQQMITVLAFDLDVRQFAAKQYWIHPALPEVTENALLGLTFK

    >gi|119964282|ref|YP_947769.1| putative uncharacterized peroxidase-related enzyme [Arthrobacter aurescens TC1]
    MAPMSILKVPSESGATGLTAEIYEADIRSMGYVPSHTKAMSLNPEAHQIWESLTQAISSSLGLRRYELVTLAAAQAIGSS
    H
    CRLAHGKKTLTIIDEEQLRAIAHDYREAGLPPEEVAMMDYAVKLSTDAAAMNDDDTQRLRDAGFSDREIADITLAAAAR
    NYFSRALLALAVELDVPPGVSPELQEALLAPLPASGD

    >gi|119963154|ref|YP_947957.1| putative Iron-sulfur cluster assembly accessory protein [Arthrobacter aurescens TC1]
    MSTATNENSTGAQLVTNDDELATHEVNLTDVAAGKVRSLLEQEGRTDLRLRVAVQPGGCSGLIYQLYFDERLLDGDAVRD
    YDGVEVVVDKMSVPYLSGASIDFEDTISKQGFTIDNPNAGGSCACGDSFH

    >gi|119960644|ref|YP_948053.1| putative glutaredoxin-like protein [Arthrobacter aurescens TC1]
    MIATNHPAQTTNTEESSVDFTPDSGTITMFSTTWCGYCNRLKKQLDAKGIGYTEINIEEVDGTAELVEQLNGGNRTVPTV
    LFPDGTAATNPSAAEVENRLAA

    >gi|119963035|ref|YP_948078.1| glutaredoxin-like protein NrdH [Arthrobacter aurescens TC1]
    MTVTVYTKPACVQCNATYRALDKKGIAYQSVDISQDAEALERLKALGYMQAPVVVTEQDHWSGFRPDKIEELAQAVSSVA


    >gi|119962075|ref|YP_948113.1| DSBA-like thioredoxin domain-containing protein [Arthrobacter aurescens TC1]
    MPEQTAPEQLASEENVNKADFWFDPVCPFAWITSRWIGEVEQVRGIETEWHVMSLSVLNEGRDLPENYRAMMDDSWGPVR
    VIIAAQELHGSSYVKPLYDAMGEQIHHEGNKDRASVIQKALAETGLPADLARFADSDEYDAQLRASHEEGISLVGQDVGT
    PVVAVNGTAFFGPVLTRIPRGEEAGKIWDATVTLAGYPHFFELKRSRTESPEFS

    >gi|119963446|ref|YP_948144.1| methionine-S-sulfoxide reductase [Arthrobacter aurescens TC1]
    MKTFVLGGGCFWCLDAVYQKTRGVSSVVSGYTGGHVRNPDYYEVCSGTTGHAEVVAVTFDETVVPEEVILDMFFALHDPT
    TLNRQGYDVGTQYRSSMFYTTTEEKVLFEEAIERAQALWSDPIVTEVSRLPEFHEAEEVHQNYYAKFPYQGYCQVIINPK
    LAKARKYYSAWLTA

    >gi|119963106|ref|YP_948159.1| putative bacterioferritin comigratory protein (thioredoxin reductase) [Arthrobacter aurescens TC1]
    MTEVQQAPASGLVPQAGQLAPDFELLNQYGEPVRLADFRGRTVVVVFFPFAFSGICTGELCEIRDNIAAFKDSNAAVLAI
    SVDSKFVQRAYAEHEQFGFELLADFWPHGAVAQKYGIFDEASGMALRGTFIIDDAGIIRYVVVNPRGQARDFSEYRRALS
    SLADQ

    >gi|119963026|ref|YP_948239.1| bacterioferritin comigratory protein (thioredoxin reductase) [Arthrobacter aurescens TC1]
    MRTRLLLLNWEIAITGKEHILAERLIPGDNAPDFTLQDETGKSMSLSDLRGRKTILYFYPAASTPGCTKEACDFRDTLGS
    LQAAGYEVVGVSPDPVKALAKFSEEEQLTFRLLSDEDHTVAEAYGAWGEKKNYGRSYMGLIRSTFVVDPDGKVSLAQYNV
    RATGHVAKLRRDLKLDK

    >gi|119962438|ref|YP_948344.1| putative thiosulfate sulfurtransferase (sseB) [Arthrobacter aurescens TC1]
    MATLISASALHQRLETGERTVLLDVRWVLGRTDGHLDYLTAHLPGAVFVDLPTELADHAQPGLGRHPLPIRDHFQDSARR
    WGINDGDTIVAYDNSGNMAAARVWWMLRNAGVDAVYLLDGGLAAWRANGYAVETGEVSPAVGNVTLGEDRMPVISESEAA
    QWHRRGVLLDARAGERYRGEVEPIDPRAGHIPGALSAPTTGNVTAEGMFLPVEELRRRFEELGLGTSSNVAVY
    CGSGVTA
    SHEIAALEIAGYRAALFPGSFSQWSNNDANDVAVGSEPFEGAGGHPSGTSTAAGSSVGA

    >gi|119961833|ref|YP_948469.1| thiazole biosynthesis adenylyltransferase ThiF [Arthrobacter aurescens TC1]
    MASIVAAHSAAPAVLPPLVEPAAELTPAEVERYSRHLIIPEIGALGQRRLKNAKVLVIGAGGLGSPALLYLAAAGVGTLG
    IVDDDVVDLSNLQRQVIHGVRDVGSPKIESARSAIAELNPLVDVVLHDIRLDASNALELFAKYDLILDGADNFATRYLVN
    DAAAILGKPYVWGSIFRFDGQVSVFWAEHGPTYRDLYPEAPPAGSVPS
    CGEGGVFGMLCAAVGSLMVTEAVKLITGVGRS
    LLGRVALFDALGGSWREIKVSKDPEAEPITELTDYEAFCGVTPLAATDQEHTVSAKDLAGMLAERESGERDFELVDVRES
    GEHSIVSIDGSVLIPQGRILSGEAWVELPQDKDIVFH
    CKAGTRSAAVLEAAQKAGYTRVRHLDGGILAWVRDVEPQKPVY


    >gi|119961186|ref|YP_948748.1| thioredoxin [Arthrobacter aurescens TC1]
    MATVDITGEQFASTIEDNDIVLVDFWAAWCSPCRQFAPTYGAASEKHTDVVFAKVDTEAEQQLAAEAGITSIPTLMAFRE
    KVLVFSQPGALNGPQLEQVIEAVKGLDMEEVHAHVAKARAEAQEN

    >gi|119963048|ref|YP_948775.1| metallo-beta-lactamase superfamily protein [Arthrobacter aurescens TC1]
    MDVVVIETPQLGDRSYLVHDGSVALVIDPQRDIDRVEGAALKAGVRITHVAETHLHNDYVTGGLILAEKHGAEYLVNAAD
    EVSFARVPVSDGQVLRVGRLLVSVVATPGHTHTHLSYVVRDDTHDGGTEAVFSGGSLLYGSVGRTDLVSPHDTAKLAHDQ
    YSSVRRLVDSAHPEAALYPTHGFGSFCSIGPASHQESSTIGEQAKSNHALTDPNEDHFVSELLANITAYPAYYAHMSPLN
    AAGVGPAALQVPDSVDAEELGRRLRSGEWVVDLRHRVAFADSHLQGSVSFEYGRGDNFTSYLGWVIPWNQPLTLLGPLSE
    VEKAIRDLARIGIDSPDAAGGPESTVLNVGALAPDHPRASYGHGDWSLLLREREPADVVLDVRRPDEYMASHIKGALNIP
    VYELLGRITELPDTRIWVH
    CATGYRASVAASLLNRAGRKVVLINARFRDAAGTGIETVP

    >gi|119961281|ref|YP_948902.1| putative uncharacterized ACR, YdiU/UPF0061 family protein [Arthrobacter aurescens TC1]
    MSEVAHSTVAFGGHFARELPELAIPWRAEEAPDPQLLTLNQPLAVELGFDPDFLRSPEGVRLLVGNALPEEATPVAQGYS
    GHQFGWYSPRLGDGRALLLGEIAGADGKLRDVHLKGSGRTPFARNGDGLAAVGPMMREYIVSESMHALNIPTTRSLAVVA
    TGRQVQRETLLPGAVLTRVAGSHLRVGSFQYARASNDMDLLRRLADHAIERHHPSSAGESNRYLALLKGVISVQAKLVAQ
    WMLVGFVHGVMNTDNMTVSGETIDYGPCAFMEGFDPGAVYSSIDEMGRYAYRSQPVVAEWNLARFAESIAALIHEDEEQA
    VALAVEALNGFRQEYSAAWFSGMQAKLGLPEGIEDDVASPLVDDLLQLVQETRADYTSFFRSLGKAARGEVEPARSQILD
    LAAFDSWLERWQALNPDADAMDQVNPIYIPRNHLVEEALASATEGDIGPAERLLAAVSHPYSERPGLEKYAEPAPESFGP
    YRTF
    CGT

    >gi|119963457|ref|YP_948985.1| Tat domain-containing protein [Arthrobacter aurescens TC1]
    MDNNLSRRGVLTAGGVLLAGLTMGLSACAQEDSLAKQAKAGDNKNYVAGDGSVTEFAKADRAAPVALKGTLFNGQTVKPE
    DLQGKVTVLNFWFAA
    CAPCRIEAPQLEALHQDFKDQGVQFFGVNLRDEQATAEAFDKTFNITYPSFNDKDGAVLLSVSGI
    VPPGAVPTTLVLDKEGKVASRVLGEIEKSTLKALITSAVAE

    >gi|119964445|ref|YP_948991.1| glutaredoxin-like domain-containing protein [Arthrobacter aurescens TC1]
    MAIPDVVLLTKADCHLCTEARAAVERVTKGLGVGWTEQKIDGDPQLQERFAEEIPVVLVNGIQRDFWKIDEERLTRTLKK
    VLEG

    >gi|119961948|ref|YP_949035.1| hypothetical protein AAur_3339 [Arthrobacter aurescens TC1]
    MVAYGIVTYRWLPCPERPRATGFYCTKYPLIVALNRIVLFYGFTPIADPDAVRLWQRALCEKLGLTGRILISKDGINATV
    GGELNNMKQYVKTTREYKGFHDIDFKWSEGGAADFPRLSVKVRDEIVSFGAPGELKVDANGVVGGGKHLQPEELHALVDA
    KKSSGEDVVFFDGRNAFEAQIGKFKDAIVPDVDTTHDFIKELDSGKYDSLKDKPVVTY
    CTGGIRCEVLSSLMVNRGFKEV
    YQLDGGIVRYGETFKDKGLWEGSLYVFDKRMHVEFSEEAKTIGECVRCSAPTNKFENCSNLSCRTLTLYCGECASSPETL
    RCPGGCEAA

    >gi|119961376|ref|YP_949205.1| bacterioferritin comigratory protein (thioredoxin reductase) [Arthrobacter aurescens TC1]
    MTQKLLVGTQAPDFALLDADGTKVSLSDYRGRNVIVYFYPKAATPGCTTEACDFRDNLASLQGKGYDVIGISPDGPEDLA
    KFTGEFALTFPLLSDEDHSVALAYGAWGEKLVDGEIVEGLVRSTVVLDGEGTVKLTQYQVSAQGHVQALKEELGV

    >gi|119963722|ref|YP_949317.1| thioredoxin-disulfide reductase [Arthrobacter aurescens TC1]
    MSNEQLIIIGSGPAGYTAAIYAARAGLNPLVLAGSVTAGGALMNTTEVENFPGFPGGIQGPELMDGLQEQAEKFGARIVF
    DDVTEVDLKGHLKRVVTGAGKTHEAPAVILATGSAYKELGLPEEKKLSGHGVSW
    CATCDGFFFREQDIIVVGGGDSAMEE
    ATFLTRFGKSVTVVVRKGELRASRIMAQRAKDNPKITFAWNSAITAIHGDTKVTGVTLKDTRTGETREQAATGIFVAIGH
    LPRTELVEGQVDLDAEGYIKVASPTTMTNLSGVFACGDAVDHRYRQAITAAGTGCAAALDAERYLAALDDADSIATALVE
    EPTHF

    >gi|119963812|ref|YP_949350.1| hypothetical protein AAur_3663 [Arthrobacter aurescens TC1]
    MSYAGDLTPQDAWAKLQEGAILVDVRTEGEWAHIGIPDTKATENDPLFIQWNLAGGIPNSRFIEDLQQQAPEDDGVELVF
    L
    CRSGQRSISAAIAATQAGFTAYNVLEGFEGEPDRYGERTVNGWKNRGLPTNLGTE

    >gi|119961614|ref|YP_949427.1| NHL repeat-containing protein [Arthrobacter aurescens TC1]
    MSETVRTQHRVRASELEGRGWLNTGGKSLDLESLRGKIVLLDFWTFCCINCLHVLDELRPLEEKYSDVLVTVGVHSPKFE
    HEADPVALASAVERYEIHHPVLDDPELATWKAYTARAWPTLVVVDPEGYIVAHLSGEGHADGLAVLLEELVAEHEAKGTL
    HRGNGPYVAPEPTSGTLRFPGKATQLPNGNYLVVDSGHHRLVELRPDLETVERVIGSGTKGYLDGQSEIAQFNEPQGVTL
    LPSELAWKLGYDAVVADTVNHRLRGVTLSSGYVQTLAGNGVQRLLDAGPARVTDTGAGTWSEHHDGGPADFAADAIDVGA
    LGLGTEVSLSSPWDVVWSEKLQRVVIAMAGTHQIFAFDPLANEVSILAGSGLEGLLDGKAEEAWFAQSSGLAIDGEDNIW
    VADSETSSLRRLVISDSGVSVETAIGKGLFDFGFRDGEASEARLQHPLGVTVLPDNSVAIADTYNGAVRRYDPATKSVST
    LARGLAEPSDVVVVQVEGSDPLLIVVESNKHQLVLVPIPKEAQQVDEGAAQTHRPKSPVTPGTLELAVRFKAPTGQKLDD
    RWGDPTQLKISSTPPELLVSGGGTSVGLLRTLELSADVPEGILHITARAAACDGPETEDGEIPDHAACHLYQQDWGIPVI
    LQADGESELVLDLRGMD

    >gi|119963743|ref|YP_949755.1| hypothetical protein AAur_4087 [Arthrobacter aurescens TC1]
    MSITASEYFRAKLECEIDVMEVAESAPGTWIVVDTRRQSSWDHGHIPGAVHIPTAQIPALAEQLVPAGSRVVVYSWGPGC
    NGSTFAALAFAELGYSVKEMIGGIEYWIRNGLPVETAAGPVQGKPDALVTAHGLS

    >gi|119962709|ref|YP_949762.1| copper-translocating P-type ATPase [Arthrobacter aurescens TC1]
    MSSQETFNQPAHRVIELDIEGMTCASCVNRVERKLGKLEGVEASVNLPLESAHVTVPASVTDQQIVDTVNATGYKATVRQ
    APAAHGHTSTKQTHERGAAVTMPRGEAGGVRQHASKGGTTEHAEHGADFAAQANHGEHGEHATHEDHMAHGPAASTLRPR
    LIVAALLTIPVFAISMIPALQFANWGWVVGALALPVVSWAAWPFHRAAAINARHFASTMDTLVSIGVIAAYLYSAWQLFV
    DPRMTEHPGMENMSGGGLYFEVAAVVTTFLLLGRYLEANAKAKAGNALKALLNLGAKDATILVDGVEQKIPADQLLVDDV
    IVVRPGEKIATDGVVTDGASAVDASLVTGESVPVEVGPGSLVTGATINTSGRLLVRATRVGSDTTLAQMGRLVSQAQTGK
    APIARLADRISSVFVPIVLVIALATFLLWLFFSGDLNAAFTAAVAVLVIACPCALGLATPVGLLTGTGRGAQLGILIKGP
    QVLEDTRHVDTILLDKTGTVTSGKLAVDHTTGLNGYSPATVLTLAGAVESASEHPIAHAIAAAAKDAMRDAGTLPGADGF
    SSAPGGGVRGSVAVDGVSKMVVVGRSGWLEENGIPLDSSQREALTAEENGGATAIWVAVDGKAAGIVSLSDTIKPGSAAA
    IQKLKGMGIRPILLTGDNAAVAAQVAAAVGISPDDVFAGVLPEGKVEAVRKLQASGATVAMAGDGVNDAAALAQSDLGIA
    MGSGTDVAIEASDLTVMGSDLGQLVQAIELSRKTLSTIKTNLFWAFFYNAIGIPVAALGFLNPMIAGAAMAASSVLVVAN
    SLRLRSFGK

    >gi|119962276|ref|YP_949864.1| thioredoxin-disulfide reductase [Arthrobacter aurescens TC1]
    MRDVIIVGSGPAGYTAAVYTARANMKPLLIAGSVTAGGELMNTTDVENYPGFPEGIMGPDLMENFEKQAARFGTEIQFED
    VTELDLDGDIKTVTIGTGETFQAKAIILSTGSAYRELGLANEKRLSGHGVSW
    CATCDGFFFKDQDIAVIGGGDSAMEEAL
    FLTKFAKSVTVVHRRDTLKASKIMGDRAQAHEKIKFVWNTAVEDVLGGDKVTGLKLKNLVDGTESELAVTGVFVAIGNDP
    RTDLIKGKVDLTPEGTIAVEGRSSRTNIKGVFAAGDVIDPTYRQAITASGSGCVAALDVEHYLADLHS

    >gi|119952409|ref|YP_950004.1| copper-translocating P-type ATPase [Arthrobacter aurescens TC1]
    MSISQAPPDAAGTDVELEIGGMTCASCANRIERKLNKLDGVSATVNYATEKARITAPAGYDPQALIQEVEKTGYTAALPA
    ARKEQASEAGAEQPDTELVSLRHRLTGSIILSVPVIVLAMVPALQFTYWQWASLALAAPVVVWAAWPFHKAAWTNLRHGA
    ATMDTLVSLGTIAALLWSLYALFLGTAGTPGMTHGFEFSIAPSDGAANIYLEVAAGVTMFILAGRYFEKRSKRQAGAALR
    ALLELGAKDVAVIRNGTETRIPVEELSVGDEFIVRPGEKIATDGVIVNGRSAVDQSMLTGESVPVEVAEGDPVVGAAVNA
    GGRLVVRATRIGSDTQLAQMARLVEDAQSGKAEVQRLADRVSGIFVPIVIAVAVAALGAWIGAGFPLEAAFTAAVAVLII
    ACPCALGLATPTALLVGTGRGAQLGILIKGPEVLESTRKIDTVVLDKTGTVTTGKMTLLAVHPSAGTDRDQLLRLAGAVE
    DASEHPIAQAIAKGATERVGQLPVPESFKNLEGQGVQGIVDGHLVLVGRASLMADWSLDIETDLAAAKADAEAAGQTAVV
    VAWDGAVRGVLAVADAVKATSAEAIRQLKELGLTPVLLTGDNRAVAEQVAAQVGIGQVIAEVLPQDKVDVVARLQKEGKV
    VAMVGDGVNDAPALAQADLGLAMGTGTDAAIEAADLTLVRGDLRAAADAIRLSRKTLGTIKTNLFWAFAYNVAAIPLAAL
    GLLNPMLAGAAMAFSSVFVVGNSLRLRSFKSKATDRQPAPAAPHTPVRPPVDA

    >gi|119952539|ref|YP_950017.1| thioredoxin family thiol:disulfide interchange protein [Arthrobacter aurescens TC1]
    MAEKVNAGTNSYVAGDGSVAEYAADIRGETVRFSGQLFDGTTLANDDWAGQVTVLNVWYAACAPCRVEAPDLSALHSEFE
    PQGVKFYGINTRDEAPTAEAFERSFGIEYPSLKDKNGKILLALTDYVPPQAVPTTLVLDKEGRVAARILGIAEKSTLKAI
    IQDALTAPDPEKP

    >gi|119952475|ref|YP_950070.1| thioredoxin family thiol:disulfide interchange protein [Arthrobacter aurescens TC1]
    MNPRIPVPPGTPQPGRRSLLLGTASAALLLAGCAKPDSLAAQAKAGDNKNYIAGDGSVSEYAPAGRGKPVQLTGRLYDGA
    TVDSSEWTDRVVMLNFWYAA
    CAPCRVEAADLEALHQEFKDDGVLFYGVNLRDTAATAAAFERNFGTTYPSFDDTDGGILL
    ALTEYVPPQAVPTTLVLDRRSRVAARILGVAEKSTLKALISDTVTEPAP

    >gi|119952304|ref|YP_950099.1| metallo-beta-lactamase superfamily protein [Arthrobacter aurescens TC1]
    MLIERIYDEDLAQASYLIGCQANGTAVVVDGRRDITVYQDLAEKNGMKIVAVTETHIHADYLSGTRELAAATGAKIYVSG
    EGGPDWQYEFDGERLYDGDAITVGNISIKALHTPGHTPEHLSFLVTDGAFSDQPGYLLSGDFVFSGDLGRPDLLDEAAGG
    IDTRFEGAKQLFASLRDKFLTLPDYVQVHPAHGAGSACGKALGAIPSSTVGYERLYSWWGPYLAANDEAGFINELLDGQP
    DAHAYFGRMKRENREGPAVMGERIPLPELSAEIVAAGLEQDTLTFIDTRPNSEVHKGTVVRSLNVPAGKSVASYGAWVVN
    PETDQNPLVLLAKDQEAAQDMWDHLVRVGIDNVAGYVTNIDGLPTFTPKLIQPEELGNFDAAMVLDVRNKTEHTAGHVPG
    SYQLSGGRAMWHLDELPAEGTIVSY
    CQSGVRNSVAASALRRAGYDVIELDGSYAAWDAWHNSRQSTKA

    >gi|119952537|ref|YP_950101.1| thioredoxin [Arthrobacter aurescens TC1]
    MATIDVTGQSFAQTLENNGIVFVDFWAAWCGPCRMFAPTYGAAAQRHPDITFAKVDTEAEQALAAAANITSIPTLMAFKD
    KTLVFSQPGALNATGLEEVIQAVKNLDMDKLRAEAGHQRT

    >gi|119952471|ref|YP_950102.1| rhodanese-like domain-containing protein [Arthrobacter aurescens TC1]
    MAEITITEAAQRRTSARILDVREDFEVEEGMIPGALHIPMGQLQARLSELDPAVPVIAVCRSGNRSAAVADALNGAGYTA
    DTMAGGMIAWTRAGLPTT

    >gi|119952274|ref|YP_950103.1| rhodanese-like domain-containing protein [Arthrobacter aurescens TC1]
    MGIISSLKKAFSKPYKTVSVAEAKDLLASGAALIDVRSAQEWRSGRAPQAKHIPLDRLQTSTAGINKNRPVIAMCQSGIR
    SASAARLLASQGYQAYSLRGGMSAWRQAGEPVR

    >gi|119952283|ref|YP_950105.1| rhodanese-like domain-containing protein [Arthrobacter aurescens TC1]
    MTSPSTAPVVTALAPETLQSWFKEHQDLVVIDVRSAAEFESMHIRGSYNVPLPLLSEHTDELAARLGSRVVLVCQSGVRA
    EQARQRLAKAGIDTAYVLTGGAPGFAAAGGDVVKGKDRWDLERQVRLVAGSLVVLGLAGGKFISPKIRTLAGVIGTGLTF
    SAATNTCAMGQAISAMPWNKAAKEPTRESAILALPVTTEVDDEAMAS

    >gi|119952390|ref|YP_950110.1| mercuric reductase [Arthrobacter aurescens TC1]
    MPEAAPDFDLAVIGSGGGAFAAAIRATNLGKRVVMIERSTVGGTCVNTGCVPSKALLAAADARHVALDGTGRFPGISTTA
    APVDMGALIDGKRSLVEGMRSDKYVDLAAEYGWDLRQGSAVFAGTPQEPALEITRPDGGRDSLTAAHYLVATGSAPWAPP
    VPGLEEVDYLTSTTAMELGEVPESLIVFGGGYVALEQAQLFARLGSKVTLLARSRLASHEEPEASRALMGVFADEGIRVI
    RRATVTSIRANASGEEVTVTATVAGGHEEFRAAKLLVATGRRAVTNGLNLDAVGVKTGNTGQILVENTLASSNPRIWAAG
    DVTGHREFVYVASAHGTLMVENAFNDAGREVDYRHLPRVTFTSPALAAVGMTDKEANEAGIRCECRVLPLEYVPRALVNR
    DTRGFIKIVANNSTGRIVGITAVGKEAGDLAAAGVYILEAGMTVDQVANLWSPYLTMAEGIKIAAQSFTTDVSKLSCCAS


    >gi|119952557|ref|YP_950199.1| putative lipoprotein [Arthrobacter aurescens TC1]
    MMIKEPQPRRRMILALGAAGVALAGCSSQDDLAEQAKAGDNKNYIAGDGSVNEYPPESRGARVSLEGTLFTGEQVAAEDW
    AGKVVVLNFWYAA
    CAPCRAEAPDLAALHTEFKDNGVLFYGVNVRDDAATAQAFERTFNVQYPSFDDSDGGILLAMTEYVP
    PRAVPTTLVLDTNGRVSARILGISQKGTLKALITAAQS

    >gi|119952603|ref|YP_950223.1| thioredoxin-disulfide reductase [Arthrobacter aurescens TC1]
    MSTDVQTEQLIIIGSGPAGYTAAIYAARAGLNPLVLAGSVTAGGALMNTTEVENFPGFPGGIQGPELMDGLQEQAEKFGA
    RIVFDDVTDVDLKGHLKRVVTGAGETHEAPAVILATGSAYKELGLPEEKKLSGHGVSW
    CATCDGFFFREQDIIVVGGGDS
    AMEEATFLTRFAKTVTVVVRKDELRASRIMAQRAKDNPKIRFAWNSAITKIHGDSKVTGVTLTDTRTGETREQDATGIFV
    AIGHLPRTELVAGQVDLDDEGYIKVDSPTTVTNLSGVFACGDAVDHRYRQAITAAGTGCAAALDAERFLAALEDADSIAT
    ALVEEPTHA

    >gi|119952554|ref|YP_950235.1| glutaredoxin [Arthrobacter aurescens TC1]
    MTSSITDYTVYTKPGCPNCDRTMEYFDSNGITYTPVDITEVPEALEYITAELGYSQAPVIVNNSDDQDHWSGLRPDKLVH
    AAMTHTTANRKEAS

    >gi|119952667|ref|YP_950321.1| copper-translocating P-type ATPase [Arthrobacter aurescens TC1]
    MSETASKQAQGIDIELEIGGMTCASCANRIERKLNKLNGVIASVNYATEKARITAPAGYDPQALVAEVEKTGYTAALPAA
    KYDQQQGEPTDWPDSELLSLKHRLIGSAVLSIPIVAMAMIPALQFNYWQWLSLAMAAPVILWAGWPFHKAAYTNLRHGTA
    TMDTLISIGTTAAFLWSLYALFFGTAGTPGMTHPFELTVAPTDGAGNIYLEVAAGVILFILAGRYFEKRSKRQAGAALRA
    LLELGAKDVAVLRDGTEVRIPTDQLSVGDEFIVRPGEKIATDGVVASGRSAVDESMLTGESVPVEVGAGDTVTGATVNSG
    GRLVIRATRVGSDTQLAQMAQLVENAQSGKAEVQRLADRISGVFVPIVIAIATGTLAAWLGAGFPITAAFTAAVAVLIIA
    CPCALGLATPSALLVGTGRGAQLGILIKGPEVLESTRKVDTILLDKTGTVTTGKMTLQGVHTAPGTDTDELLRVAGALED
    ASEHPIAQAIARGATQRVGDLPIPESFKNIEGRGVQGVVEGHLVIVGRESMLEDWSLTMPVDLARAKAQAESARETAVIV
    AWDGEVRGVLTVADAIKDTSAEAITQFRALGLTPVLLTGDNRVVAEQVAAQVGIDKVIAEVMPQDKLRVVKDLQKQGKVV
    AMVGDGVNDAAALAQADLGLAMGTGTDVAIEAADLTLVRGDLRAAADAIRLSRKTLGTIKTNLFWAFAYNVAAIPLAALG
    LLNPMLAGAAMAFSSVFVVTNSLRLRSFKSQAGNPSPAAVRSRARQPIDA

    >gi|119952773|ref|YP_950335.1| metallo-beta-lactamase superfamily protein [Arthrobacter aurescens TC1]
    MLIERIYDEDLAQASYVIGCQRTGEAIVVDPRRDIAVYQTVAAANGMKIIAVTETHIHADYLSGTRELAAATGAAIYVSG
    EGGTDWQYEFDGKRLFDGGTITMGNIGVHALHTPGHTPEHLSFLLTDGAFSDQPGYLLSGDFVFAGDLGRPDLLDEAAGG
    VDTRFNSARQMFTSLRDKFLTLPDHIQVHPGHGAGSACGKALGAVASTTVGYERLYAWWGPYLSANDEEGFIKALLDGQP
    DAPAYFGRMKRQNRQGPALLGERMPLAELEVGAVAEDLAAGNVTFVDTRSNTQVHDRGIHDALNIPAGRSTATYAAWALD
    PERDVRPVVLLAKGQEMAQELWDHLVRVGIDNLQGYVTAIEGLPLSSPRLVNPEEIEGFEASLVLDVRAKNEHTAGHIPG
    SQQLHGGRVLWNLDQLPDRGPIVTY
    CQSGVRSSVVASTLRREGYDVVELKGSYAAWAARECANRL

    >gi|119962174|ref|YP_947145.1| DSBA-like thioredoxin domain-containing protein [Arthrobacter aurescens TC1]
    MSAVISGRRVRIAIWILLGAIVGAGAIWYAVLTANKPAPAAPLAAAEARLVREDSHRVTSPAMEKAQLVEFLDFECESCL
    AAEPLVEELKKEYGDRITFVHRYFPLPGHRNSGAAALAAEAAAQQGRYQEMAAKLFATQSEWGEKQTSQAAQFRTFAQEI
    GLEMDQYDAAVADQASKDRISRDVADGKALGVTGTPTFFLNGKKLTLNTEAQFRQLLDDAVR

    >gi|119952493|ref|YP_950064.1| thioredoxin domain-containing protein [Arthrobacter aurescens TC1]
    MDKTKKAKIALWILLGLIVIGGIIGFTVARNAVTVAEPTGGGQVVREDSRVLSQAPDEKAQFVEFLDFECESCLAAYPFV
    EELRAEYGDNVTFINRYFPLPGHKNSMNAALSVEAAAQQGQYEAMYRKMFDTQKQWGESSDDQSALFRTYAEDLGLDMAA
    YDAAVADPATRERIEVDKADGQALGVSGTPTFYLDGKLLEPKTLDEFRSLVEAAANGS