Nitrosomonas europaea ATCC 19718 uid57647

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|30248134|ref|NP_840204.1| putative unknown proteins [Nitrosomonas europaea ATCC 19718]
    MPNHLAGETSPYLLQHAENPVDWYPWGEEALEIARMLDKPILLSIGYSACHWCHVMAHESFEDAQVATAMNEHFVNIKVD
    REERPDIDQIYQSAHYTLNHRSGGWPLTMFLTPEQKPFFGGTYFPKEARYSMPGFLELLPKVAELYRTRKTDIEKQNAVL
    LKLLAQSLPAPDTRASALSRQPIDRAWEQLNRLFDETDGGFGDAPKFLHPAELQFCLRRYVTDNDTRALHVVTHTLEKMA
    QGGLYDQLGGGFCRYSTDHSWQIPHFEKMLYDNALMLPLYAETWLVTGNPLFKQVVEETAAWVIREMQSGIDGEGGYFSS
    LDADSEHEEGKFYVWDRQAVSAILTPEEYRVTAAYYGLDRSPNFENHHWHLAVTESIETVAARHQISQEAVQQLIDSARR
    KLLNEREQRIRPGRDEKILTSWNALMIKGMTRAGQIFEREEWISSAVRALDFIRSRLWQNDRLLATFKDDKAHLNAYLDD
    HAFLLDSLLTLLQADFRQTDLDFAITLADVLLTRFEDKTSGGFFFTSHDHETLIHRPKTGHDGAIPAGNGIAATTLQRLG
    HLLNEQRYLEAAERTLNVFSSGLSLHASSHCSLLITLEEFLEPTKTVILHGNRPELQIWLKALLPYSLDKIVIALPLELS
    ELPDSLKMRSTPDGKISARVCEGRRCLPEIHSLNELLQMCKLHGRMALP

    >gi|30248163|ref|NP_840233.1| hypothetical protein NE0137 [Nitrosomonas europaea ATCC 19718]
    MRPAARVIIAPAKMFLFSVTYLTVEIMKKSTTVEKIKAPELITSDWLNTPQPVTLASLRGKVVLMHAFQMLCPGCVQQGI
    PQTQRIFDEFDPDRVAVIGLHTVFEHHEVMGRDALEVFAYEYRLRFPIGIDKPNEQHSIPHTMMTYHMQGTPTTILVDKT
    GHLRLHKFGHVSDLLLGVSIGTLLAEEVSDEELAAGSTDSAGNESDTQPGCDADGCRV

    >gi|30248383|ref|NP_840453.1| thioredoxin:DSBA oxidoreductase [Nitrosomonas europaea ATCC 19718]
    MTVRKMICFLLSFIVVNLAGVLIAHAEIVEGRDYTVLSAPQPTEGDSEHIEVIEFFWYGCPHCSDLHPHLSRWLENKPAD
    VAFRFVPAILRNNWVPGAKTFYAMESLGLTQTLHDKVYHAIHREKTDLSKEATLFDWIGKQGVDRDKFIGAYNSFTVQNQ
    ANRSAQMIRQYKLTGVPALVVDGRYLTSGKAGGTPQDTISVLNQLIEKVREEKKSR

    >gi|30248531|ref|NP_840601.1| hypothetical protein NE0516 [Nitrosomonas europaea ATCC 19718]
    MKLAKLLLTLVLASFACLTVANPMWEPDLPRAKSAFEKETRVPLRAGHYIEPTLFKGFYAVRTGQAGGPSAYFREDMGWL
    GNIKSPGWVIQSPAEDNPAYKHTWLRQQLAQIPLEQLVLVKRSTPPVAVIWSAPD
    CPYCRKLEKTLEQENASVYVVPVGV
    AENGFRQAARVYCADDPSQAWRKVMQGSEINGRAKTSCQYPRDMLNDIGFFLGMGRMATPIVVFADGSTVIGWNDQNAWM
    LLRKKISEQIFFND

    >gi|30248742|ref|NP_840812.1| AIR synthase-like protein [Nitrosomonas europaea ATCC 19718]
    MPWAGTAGVFDTSTSFPIPSSSQERFLFRTIMPSEKIALTQTVQKGGCAAKVAATELRRILQQVGFPAAHPALMVDGRYF
    DDAAIYRVNEETALVQTLDFFTPIVDTPKLFGEIAAANALSDVYAMGGRPVTAMGILAFPLAALPEQVIVDVLQGASDKI
    AEAGANFVGGHSIDDDTLKFGLSVTGFVNPRQVWTNAGARPGDHLILTKALGTGTMTAAVKRQQLREEDIIEALDSMTAI
    NNAIDCMSPDLQASIHAATDITGFGFSGHAMQLANASDVTLCIETGNLPRFDKTFHCLENGCLTKAHRTNAEYTTPHIDD
    STLDALHKLLIHDPQTSGGLLLSVAPETSQTMLQALHTRFPSAVIVGTVHPHQDKAVQFA

    >gi|30248773|ref|NP_840843.1| periplasmic protein thiol:disulfide oxidoreductase DsbE [Nitrosomonas europaea ATCC 19718]
    MMRFLLPLAAFVVLVIFLGVGLTLNPRQVPSPLVDKPAPPFRLQQLYDTTKTLSSEENLGKVWMLNVWASWCVACRDEHP
    VLVELSKLGIVPIYGLNYKDQRDTAMQWLKQFGNPYEISIVDADGKVGINYGVYGVPETYVIDKQGIIRYKHIGPVTVES
    LKNKILPLIKELKS

    >gi|30248776|ref|NP_840846.1| bacterioferritin comigratory protein [Nitrosomonas europaea ATCC 19718]
    MSDDLIPDFELASTGNKQFRLSDVKSRYLVIFFYPKDDTPGCTSESQQFRDLYPEFVQIGCEIVGISRDNLKSHDKFRGK
    YDLPYDLLSDSDEVVCELFGVMKMKNMYGKQVRGIERSTFVLDRDGKVYKAWRGVKVPGHAEEVLAFIKSVTA

    >gi|30248778|ref|NP_840848.1| dihydrolipoamide dehydrogenase [Nitrosomonas europaea ATCC 19718]
    MHKFDVVIIGAGSAGLSALREVKKHTDNFILINEGPWGTTCARVGCMPSKLLIEAANAFYRRVSFNEFGITGADQLGVDH
    KRVLQRVRRLRDDFVTSTLGATRELGERAISGRAHILSPHQVMVNGEKFHTRKIIIATGSRPVVPEPWQSLGKRLFTTDT
    LFEQEALPERIAVIGMGPVGLEMAQALSRLGVRVTGFGSGRMIGGITDPLINQAAVTLLSKEFSLHLGTRADITVNVDSD
    VITVNSGDIRIEVDSVLAALGRRPNIDDINLEALGVPLDERGLPPVNPDTLQIADLPVFLAGDVNQRSPVLHEAADDGHI
    AGLNATREKLVCFKRRVPLTIVFSDPNIAVVGKSFRSLEHEDIRAGEVDFSRQGRARSAQSNRGVLRVYAAANSGRLLGA
    EMCAPAGEHFAHLLALAIDQSLSVWDLLRLPFYHPVLEEGLRTALRNLASKLPACSESDLAVCGPFNAEALD

    >gi|30248784|ref|NP_840854.1| hypothetical protein NE0780 [Nitrosomonas europaea ATCC 19718]
    MASLETPVCNFGWKAVDFDLPGVDGKRYNLASVMGENGLLVMFICNHCPYVKAIRDRIIRDTREFAEHGIGAIAIMSNDP
    ADYPEDSFENMAKVAREYAYPFPYVQDETQEIAKVYGAVCTPDFFGFNNKLELQYRGRMDASRKEAAPADARRELFEAMV
    QVARTGRGPEEQIPSIGCSIKWRED

    >gi|30248816|ref|NP_840886.1| putative sspA; transcription modulator protein [Nitrosomonas europaea ATCC 19718]
    MMTLYSTATCPFSHRCRIVLHEKDMDFQVIDVDPNNIPEDIAVISSYSKVPILVERDLVLYEANIINEYIDDRFPHPQLM
    PAEPVMRARARLLLHRFEKELFCHIESLEQGDHKTADKARAEIADGLTMIAPIFEKQKYMLGDEYTMLDVAIAPLLWRLD
    HYGVKLPKQAAPLLKYAERLFSRPLFIDALTPSEKLMRK

    >gi|30248843|ref|NP_840913.1| putative mercuric reductase [Nitrosomonas europaea ATCC 19718]
    MTTLKITGMTCDSCATHVKQALEKVPGVQSAVVSYAKGAAQLDLDPGTAPDALTAAVAGLGYKATLADAPPTDNRTGLLD
    KVRDWMGAADKGSDGEHPLQVAVIGSGGAAMAAALKAVEQGAKVTLIERGTIGGT
    CVNVGCVPSKIMIRAAHIAHLRRES
    PFDGGIPATAPAIDRSKLLAQQQARVDELRHAKYEGILDGNPAITVLHGEARFKDDQSLVVRLNAGGERVVVFDRCLVAT
    GASPAVPPIPGLKESPYWTSTEALVSDIIPERLAVIGSSVVALELAQAFARLGSQVTILARSTLFFREDPAIGEAITAAF
    RAEGIKVLEHTQASQVAHVDGEFVLTTARGEIHADKLLVATGRTPNTRSLALEAAGVAVNAQGAIVIDKGMRTSAPHIYA
    AGDCTDQPQFVYVAAAAGTRAAINMTGGDATLDLTAMPAVVFTDPQVATVGYSEAEAHHDGIETDSRTLTLDNVPRALAN
    FDTRGFIKLVIEEGSGRLIGVQAVAPEAGELIQTAALAIRNRMTAQELADQLFPYLTMVEGLKLAAQTFNKDVKQLSC
    CA
    G

    >gi|30248845|ref|NP_840915.1| mercury scavenger protein [Nitrosomonas europaea ATCC 19718]
    MKKLFASLALVAVVAPVWAATQTVTLSVPGMTCAACPITVKKAISKVEGVSKTDVSFDKREAVVTFDDTKTNVQKLTKAT
    EGAGYPSSVKR

    >gi|30248846|ref|NP_840916.1| putative mercuric transport protein [Nitrosomonas europaea ATCC 19718]
    MSEPQNGRGALFAGGLAAILASTCCLGPLVLVALGFSGAWIGNLTILEPYRPIFIGAALVALFFAWRRIYRPAEACKPGE
    VCAIPHVHTTYKLIFWIVAVLVLVALGFPYVMPFFY

    >gi|30248889|ref|NP_840959.1| methylated-DNA--protein-cysteine methyltransferase [Nitrosomonas europaea ATCC 19718]
    MNYYTFLESPVDRLLLTSDGEFLTGVYMEIEIQKLLPRMTDDWRQDAAPFAEAIAQLNAYFAGELIQFDLPMKATGTPFQ
    EAVWQSLSTIPYGETVSYKNIAERLHLPKAARAVGMANGQNPISIIIP
    CHRVIGANGKLTGYGGGIHRKQWLLAHEDKQT
    SFA

    >gi|30249022|ref|NP_841092.1| copA; copper-transporting ATPase [Nitrosomonas europaea ATCC 19718]
    MTCAACAARIEKNLNKLPGVHAAVNFANEKALIKFDHDSTHPEELVQSIEKAGFQVPEQTVQLQISGMTCAACANRIETV
    LNEIPGVRAILNPAAEIAYISFNPAITSVEQLVSAVEKAGYGANQISDDNYVKEQSRNQAAYRKELRIFWISAALTVPFM
    LEMIMMLTGNHNNLLPYWLQWLLATLIQFWPGRRFYISAWRTLRGGGANMDVLIALGTSMAYLFSTAVIILQLDQHVYFE
    ASAMIITLVLLGKLMETRAKRKTSAAIETLIKLQPKTARVERDGEIIEIDINSLKNEDIFLVRSGESLPADGIVIEGSSS
    INEAMLTGESQPVTKQVGAKVYAATQNQHGLLKCRVTGVGKNTQLAAIIRLVEIAQGSKAPIQRMADTVSGIFVPIVIGI
    SILTLGLTWWLTGHFVIALINAVAVLVIACPCALGLATPTAIMVGTGRGAQEGILVKNATALELAEKIQMLVVDKTGTLT
    EGHPSVTDIIVADEVNEHDLLQIAASLEQGSEHPLAKAVSQYASSSKIRLLAITNFASVTGSGIKADIDNASYILGSPKF
    LAEKGAVLDQQRITALQTEGKTVVGVAIQINESVRVIGYLAIADSLRETSIKAIQRIQNLGIDVMMLTGDNPTTAAAIAK
    QAGIKIFHAEVSPQNKAAEIEKIKANGQFVGMVGDGINDAPALAAANVSFAIGAGSDIAIEAADITLMRNDLMSVADAIS
    LSRSTLHKIRQNLFFAFFYNILGIPLAAAGMLSPVIAGAAMAMSSVSVITNSLLLKRWRAGV

    >gi|30249037|ref|NP_841107.1| thioredoxin [Nitrosomonas europaea ATCC 19718]
    MSQHIHYVTDASFESEVLQCPVPVLVDYWAEWCGPCRMIAPLLDEIASEYGDRLKIAKLNIDENQSTPQKYGIRGIPTLM
    IFKNGNIEATKVGALSKSQLTAFVDSHL

    >gi|30249123|ref|NP_841193.1| hypothetical protein NE1136 [Nitrosomonas europaea ATCC 19718]
    MKANIAWQEGVSFLGQVGSGHSVLMDGAPEAGGKNLGPRPMEMILLGLGGCTAFDVVHILRKGRQVITGCQVEMDAQRAT
    EDPKVFTHIHLHFIITGKNLDPRHIERAISLSAEKYCSASMMLKATVDITHDYEIIVG

    >gi|30249162|ref|NP_841232.1| disulfide bond formation protein DsbB [Nitrosomonas europaea ATCC 19718]
    MRIIFLLIALICAGLVSYALYLQLADGLLPCPLCIFQRMAYWLVGITALFAFIHHPQRLGRRIYCGLIILFSLAGAIVAG
    RQAWLVRFPEAFE
    CGISPEEAFLNELPLARWWPDMFEANGDCTDGTWQFLSLTIPDWSLLIFLAFSLIAGLLWRSRSISS
    SNLK

    >gi|30249191|ref|NP_841261.1| glutathione peroxidase [Nitrosomonas europaea ATCC 19718]
    MNIYDCGIKTMDGQDKLLGDYKGKVLLIVNTASKCGFTPQYQGLEDLYRRYKDRGFVVLAFPCNQFGHQEPGSESEIQQF
    CTTRYDVSFPVFAKIEVNGANTHPLYRYLKNEKSGVLGTKAIKWNFTKFLVDRSGHVVRRYAPADKPESLTGDIEQLL

    >gi|30249298|ref|NP_841368.1| thioredoxin [Nitrosomonas europaea ATCC 19718]
    MKRWFTIFLLVLIGYLPVFEAGAYGFRFEDSSGKTHTLSGYKGKWVLVNFWATWCPPCLREIPDLSELSRERNDIVIIGI
    AMEYDDARDVMKFVEKMTIPYPIVLGDRTAAAQLGDELSMLPSTYLFDPDGKPAARKIGLITRAEIEAFINTH

    >gi|30249399|ref|NP_841469.1| iron-sulfur cluster insertion protein ErpA [Nitrosomonas europaea ATCC 19718]
    MGTTIHEETSAAQPPLNFTDGAASKVKELIEEEDNQALKLRVFVSGGGCSGFQYGFTFDEIVNEDDFVMEKQGVKLLVDS
    MSFQYLVGAEIDYQESAQGAQFVIKNPSAASTCGCGSSFSV

    >gi|30249422|ref|NP_841492.1| hesB/yadR/yfhF family protein [Nitrosomonas europaea ATCC 19718]
    MAITLTERAARQIRQQLERRGKGVALRLGVKKSGCSGFAYSFDYADEVQEDDQLFESHDAQVVVQRDQLSFIDGSEIDFI
    QEGLNSSFKFRNPNIDNTCGCGESFSLKT

    >gi|30249482|ref|NP_841552.1| hypothetical protein NE1511 [Nitrosomonas europaea ATCC 19718]
    MHLFLRSLILPGLFFAGIVLADSADLKETIQAHFPESKIESVTQTPYLGLYEVVIDGEVFYTDKKADYFFMGHVVDAKRR
    VSLTSERMQQIRDARRIAIDTLPLEHAMKTVKGNGKRMLIVYSDPN
    CPYCKRLEKELVNVTDVTIHTLLYPILNGSMTTA
    EAIWCSEDRVKAWDDFMLRSVAPAGKDCQTPLQKLLESGRENRVTGTPTLIFADGSVVPGFIPQQEIEKRLDQAASK

    >gi|30249499|ref|NP_841569.1| signal peptide protein [Nitrosomonas europaea ATCC 19718]
    MMRRLLFIWLLTIAGVASATEGVRPFVLGSMTQIQEEHAGKPFVLFLWSLTCTYCPTELKMLGEFKQQHPDLNLVLIAAD
    TPDDEPEIVSHLADYGLNKVERWVFAEDMPERLRFEIDRRWYGEVPRTYFYDQSHQREAKTGLVGQEYVKSWLARVGMDA
    SSASK

    >gi|30249640|ref|NP_841710.1| putative arsenate reductase [Nitrosomonas europaea ATCC 19718]
    MGDKITIYQKPTCSKCREALSILKESGREFDSINYYDDRLTVEVLRELVRKLGISVRDLLRADEPLARGTESVDDDELLR
    LMAANPDLIQRPIVVRGDSAVLGRPPERIKKLLDN

    >gi|30249663|ref|NP_841733.1| msrA, pms; peptide methionine sulfoxide reductase [Nitrosomonas europaea ATCC 19718]
    MKIIIAALTGLIMVVTVFAMEKTVTPNSVNVKQTIDSKTDYIVLGMGCFWGAEKRMGELSGVIDVESGYAGGDHADAGYQ
    DILNFEHALRAGKTAGRNHAEVVKVTFDPAQVALEHVLARFWESHNPTQGDRQGNDIGSNYRSAVYYHDENQKTLALTTR
    KIYQQALATAGYGQITTEILPLKNYITAEEYHQNYLQKNPDGYCGLGGTGVKYPAPDQHIIRGDTSSVPASPSPQSLDGK
    NLNFDQQLVIFESENCEFCAQFDRDILAHWQADIPMVATKNTNPPADWTLDKPLFAAPTIVLFREGKEVVRYTGYTGEKE
    NFWQWLGFQMLTPEQQKIAFQQGTERPFTASNLDEKRPGRFVDPITGATLFFSKTKFNSGTGWPSFFEPVEGSVTYHEDH
    SGYMQRIEVRSASSGIHLGHVFDDGPPPSYKRY
    CINGNVLKFIPD

    >gi|30249743|ref|NP_841813.1| NAD binding site:UBA/THIF-type NAD/FAD binding fold [Nitrosomonas europaea ATCC 19718]
    MDDQQLLRYSRHLLLPEIDIPGQKKLTHSSVFILGAGGLGSPAALYLAASGVGKLTICDHDQVDLTNLQRQILHETASIG
    KFKTDSARNTLQRINPEIEIISLPEQATARLLNREIKSVDAVIDASDNFSTRHLINQACLAHRKPLISAAAVRFTGQITV
    FDLRHPDSPCYHCLFPDSGDSDDPA
    CAIMGVFSPLTGIIGCIQAAETIKVLLGIGETLHGRLLLLDGLTMHWRSLKLSKD
    PQCPTCHSASVQNLSDSQ

    >gi|30249863|ref|NP_841933.1| glutaredoxin-like protein [Nitrosomonas europaea ATCC 19718]
    MDVVDSIEKQVSSHPVVLYMKGTPQQPQCGFSANAIRILNACGVEDFFAVNVLADPEIRQGIKDYSSWPTIPQLYVNGEF
    IGGSDIMSEMYQNGELQKLFEK

    >gi|30249881|ref|NP_841951.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Nitrosomonas europaea ATCC 19718]
    MTTTRHCKLLILGSGPAGYTAAIYAARANLNPVLITGMAQGGQLTTTTDVDNWPADVAGVQGPELMERFLKHAERFQTEV
    IFDHIHTANLSEKPFELIGDQGTYTCDALIIATGASAKYLGLPSEEAFMGKGVSA
    CATCDGFFYKNQDVAVIGGGNTAVE
    EALYLSNIARKVTVVHRRDKFRSEKIMIDKLMGKVKSGKIELALDHVLEEVKGDDSGVTGIRIRHVRDDTARDLELQGVF
    IAIGHHPNTDLFQGQLEMKNGYIITQGGNEGNATATSIPGIFAAGDVQDHIYRQAITSAGSGCMAALDAERYLEKSA

    >gi|30249892|ref|NP_841962.1| hypothetical protein NE1944 [Nitrosomonas europaea ATCC 19718]
    MAAPDIKTIVNGINIKQSFAIQNQIRDGGDGELAKPRYQATVVWDSGYHTTSNVTDGQIIIGDEPVHYGGEGMGITPQDL
    LLTAVGH
    CLAASYIGGLSAAHINVESLHVHVSGRVNFRAAFAVEPGNPGFEDISVIVEIQTDAPQEQVTALLEKLKHMAP
    IPDTIMRPVPVNIEIRHQLK

    >gi|30249974|ref|NP_842044.1| putative inner membrane protein [Nitrosomonas europaea ATCC 19718]
    MSLAEFRAQYLVRFWSPIPALLALGVASAYYFAITGTFWAVTGEFTRWGGHIAALLGFSPQQWSYFQLIGLNGSPLERID
    GVMIIGMFAGALCAALWAGNVQLRWPTSRRRLAQGLIGGIIAGFGARLAMG
    CNLAAFFTGIPMFSLHAWAFMLTTVIGAW
    IGVKLCLLPFLRTPLRLDTAPSSLFADTASLARRARLQNRLGLLIAVLVLGFAAWRFETSLVLGLAVLFGVFFGAVIERG
    QICFTSAARDLWTTGRTRIAYGILLGMVVACLGTFGAIALGATPKIFWMGPNAALGGLLFGIGIVLAGGCETGWMYRAME
    GQVHFWIVGIGNVIGGTLVAIFWDELGGTLALPYPKINLLEYLGAGTGLLLSLAGLMLAMLLVYLNARRFAVREGLAR

    >gi|30250091|ref|NP_842161.1| dihydrolipoamide dehydrogenase [Nitrosomonas europaea ATCC 19718]
    MAISENKTMTQFIKVTLPDIGDFQEVPVVEILVSPGDEVEQETPLLVLETDKASMEVPAPQAGIVREIHVKAGDRISQGS
    LIVTLETRETDTQVASPTPPRDTMAVPDSQPTITSAAEATAGKVALASVADRGDIHAEVVVLGAGPGGYTAAFRAADLGK
    QVVLIERYPALGGV
    CLNVGCIPSKALLHAAKTLTEAKEASLYGIRFGQPEIDVGKLRSWKESVVGKLTKGLSMLARQRKV
    TVIHGTGKFVNPHLIEVETSDGIKTISFDHCVIAAGSSAARIPGLPADERIIDSTGALALAEIPERMLILGGGIIGLEMA
    TVYHALGTRISIVERMAQLIPGADTDLIKPLYKKLKTECEAIYLNTSVSRVEADKEGLQVFFEGEQAPEPQRYDRVLVAV
    GRRPNGKLIDAGAAGINVDERGFIPVDKQMRTSVPHIFAIGDIAGDPMLAHKASHEGKIAAEVIAGHKVTFDARTIPSVA
    YTDPEVAWMGLTETEAEKQGIAYEKAVFPWAASGRAITMTRDEGMTKLLFDKVSKRILGAGMVGPHAGELIAETVLALEM
    GADMQDIGLTIHPHPTLSETILFAAELAEGTITDLYVPKK

    >gi|30250143|ref|NP_842213.1| glutaredoxin [Nitrosomonas europaea ATCC 19718]
    MPKIVMYVSGYCPYCTMAEKLLRARGVEEIEKIRVDLQPGLRAEMMQRTGRRTVPQIYIGPVHVGGYDDLAMLDRQGELS
    GLLAG

    >gi|30250230|ref|NP_842300.1| NAD(FAD)-dependent dehydrogenase [Nitrosomonas europaea ATCC 19718]
    MTSYLSEEAGPDLTQGISLSDFGNQPLLRGHVGDEPVILARIGDEITAVGATCTHYGAPLTEGLVVGETVRCPWHHACFS
    LRSGEALGAPAFDPLPCWQVERDGDRIMVRDKITPKPRSIPVAAANQPANVVIIGGGAAGFACAEMLRRRGYQGQLTMLS
    EDSDAP
    CDRPNLSKDYLAGNAPEEWIPLKSDDFYVRNRIDLQLHTTVTKINTTGHTVTTADGRIFPFDRLLLATGAEPVR
    LPIPGANQSHVFTLRTLADSRAIIERAKHAKAAVILGSGFIGLEAAAALRARELDVHVVSLDKHPLEKILGSEPGDFIRS
    LHEQHGVQFHMGTSLAHIEPHKVVLSNGKELTADLVIIGVGVRPCVSLAEAAGITVDNGILVNEYLETSVPGIFAAGDVA
    RWRDEASGKTQRIEHWVLAERHGQIAAENMLGANTAFQDVPFFWSAHYDISIRYVGYAGPWDTLEIEGDMAAYDCLISYK
    TGGKTVAVAAIGRDKQALEYRALIAQQQH

    >gi|30250246|ref|NP_842316.1| dihydrolipoamide dehydrogenase [Nitrosomonas europaea ATCC 19718]
    MDNLFDVAVIGAGPGGYVAAIRCAQLGLNTVCIDDWKNEQGKPSLGGTCLNVGCIPSKALLESSENFERAGHKFAEHGIK
    VDGLSIDVPAMIARKNKIVKAFTGGIGMLFKKNKVTALHGRGTLQKHDQARDGGDDSWEIQVSADGKEQSVHARHVIIAT
    GSTPRTLKVAPVDGNNVLDNAGALALQQTPGKLAIIGAGVIGLELGSVWRRLGAEVTLLEAQADFLPAADEQVAKEAYKA
    LTRETGLTIHTGVEIKSTRASENGVEIDYVDRDKNAQNLKVDKLIVAVGRVPNTSGLGAEAAGLKLDERGYISVDEFCQT
    SLQNVYAIGDVVRGPMLAHKASEEGVAVAERIASGRQGATDSSGHVDLGMMPWVIYTAPEIAWVGKTEQTLKAEGVAYKA
    GQFPFMANGRARALGETTGFVKILADAESDRILGVHMVGPYVSEMIAEAVVAMEFSASSEDLARIVHAHPSLSESLHEAA
    LGVDKRAIHI

    >gi|30250255|ref|NP_842325.1| putative thioredoxin [Nitrosomonas europaea ATCC 19718]
    MNNQVEPRKLVVYGREGCHLCEEMIASLRVLQKKSWFELEVINIDGNEHLTRLYNDRVPVLFAVNEDKELCHYFLDSDVI
    GAYLS

    >gi|30250280|ref|NP_842350.1| molybdopterin/thiamine biosynthesis family protein [Nitrosomonas europaea ATCC 19718]
    MRLPPLVNPAAELSKDEISRYSRHLLIPEVGLIGQRRLKSSKVLVIGAGGLGSPVLLYLAAAGVGTIGIIDFDVVDESNL
    QRQIIHGQSDIGRPKSESACDAINELNPYVKVNLHRERLEVVNAHAVISGYDLIVDGTDNFATRYLVNDACVLADKPYVW
    GSIFRFEGQVSVFWENAPGGKGLNYRDLYPEPPPPEMAPS
    CAEGGVLGILCASIGAMMATEAIKLITGIGETMLGRLAVY
    DALEMSYRFIPLHRAPNRTAIDGLIDYQRFCSVNPVSATYADTIPVISARELKAIKENGTDVQLIDVRGIEEWDIVHIEG
    AKHIPKSRIMSEEVLAAMNKEDFIVLH
    CKMGMRSRDVLLEMQKQGFTNVKSLDGGILAWIREVDQSLPIY

    >gi|30250314|ref|NP_842384.1| thioredoxin:cytochrome c biogenesis protein transmembrane region [Nitrosomonas europaea ATCC 19718]
    MRWIKTILLLLCLVSTHTMAEEGSSGGLMSILQRLGVGSEQTEQELLPPDEAFKLSLEVRDDRTLIARLTPAKDYYLYRD
    KINFESKSAGIHVDQVALPPGKMKQDPAFGQTEVYYQPLEAIISLRRDASAPEQLSLSATYQGCNEPIGVCYAPINKVND
    ILLPTVKAAIDTVAGTISGDVQAAGATGTDATAELFQTDNAPLFETESYKIERLFASGNFWLILSGFFGIGLLLAFTPCV
    FPMFPILSGIIASKGQQMSKLRGFMLALAYVLGMAITYAIAGAAAGLSGTMLSAALQNAWVLGTFALVFVALAFSMFGFY
    ELRMPSFIQNKLVEETGHFKGGQLTGVFGMGALSALIVSPCVAAPLAGALIYISQTRDVVLGGSALFIMALGMGMPLLLL
    GVSAGALLPRSGAWMKAVQQFFGVLLLAVAIWLVSPVITEVVHMLLWAALLIISAIYLHALDPLPGHASGFNKFLKGIGV
    IALLVGVALLIGVLSGSRDILQPLSKLSLAAATPSGQLAEPSVNTNESLPFKRVKTTAELDELIRQSQGRYVMIDFYADW
    CISCKEMERFTFTDPQVQARLKNVELVQINVTDGTPDDAALLKRFKLFGPPGILFFDRQGVEIPNIKIIGYLDKRDFITV
    LDAILL

    >gi|30250315|ref|NP_842385.1| thioredoxin [Nitrosomonas europaea ATCC 19718]
    MSKPNRFSFYVIVAILSLAAGFAYKSREMGITVSLSSADRKAGADKFFDATLSALDGTPQALSQWRGKIVIANFWATWCL
    P
    CRDEIPELIDTYTAYHQKDLVILGIAIDDTDKVAAFSKEFNINYPVLVGEFDAFSLAEAMGNLQGALPFTVTIDRSGMI
    VDTHLGRIKKKQIEEIIKPMLQ

    >gi|30250318|ref|NP_842388.1| Na(+)-translocating NADH-quinone reductase subunit E [Nitrosomonas europaea ATCC 19718]
    MNSLAGLFITAVFVENLALTFFLGMCTFLAISKKIEVAFGMGIAVIVVQTLTVPINNLVYQYLLRDGALVWAGLAEIDLT
    FLGLVSYLGVIAAIVQILEMFLDRFMPALHSALGIYLPLIAVN
    CAILGGSLFMVERDYNFTESLVYGLGSGFGWALAIVA
    LAGVRERLKYSDVPDGLQGLGITFISAGLMAMGFMAFSGIRL

    >gi|30250319|ref|NP_842389.1| Na(+)-translocating NADH-quinone reductase subunit D [Nitrosomonas europaea ATCC 19718]
    MMAQSVRKILFTPVVNENPITLQVLGICSALAVTSKVSTALTMCIALTLVVACSSMLISLIRHYIPTNIRIIIQMTIAAS
    LVIVVDQFLRAFAYEVSRELSVFVSLIVTN
    CIVMGRAEAFAMKNPPWPSFLDGLGNGLGYSAILLIVGIIRELFGSGSLL
    GVTILPLIRDGGWYEPNGLLLLPPSAFFLIGLIIWGVRSWKTNQVEQPEFRIQQTHNPTEIIR

    >gi|30250386|ref|NP_842456.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nitrosomonas europaea ATCC 19718]
    MSLINTTVKPFKATAYHNGDFVEITDKTLKGKWSVIVFYPADFTFVCPTELEDLADNYDEFQKIGVEVYGVSTDTHFTHK
    AWHDTSSVVRKVRYPLVGDPTRELSRNFDVLIEDAGLALRGSFIINPEGEIKAFEVQDNNIGRNAAELLRKVKAAQYVSM
    HEGEVCPAKWTEGAATLKPSIDLVGKI

    >gi|30250489|ref|NP_842559.1| transmembrane protein [Nitrosomonas europaea ATCC 19718]
    MIDWQSFTPASAFTGGMIIGLATALLLLITGRIAGISGIIGGLVELRRGDFAWRAAFVSGLLLAPWLWQWLGELPPVHIE
    TSHTVLALAGLAVGIGTRYGSG
    CTSGHGVCGLSRLSPRSMVATVLFMIMGMMVVYVVRHSLS

    >gi|30249023|ref|NP_841093.1| heavy metal-binding domain-containing protein [Nitrosomonas europaea ATCC 19718]
    MQAFNTLFSFLQGIFMPTTIVHIKGMFCGGCVSSIKTVLGKIPGVNSVEVSLNDGQAVIQHDESLKEEVVNQAIEGAGFE
    VVKQ