Nitrosococcus watsoni C 113 uid50331

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|300112768|ref|YP_003759343.1| glutaredoxin 3 [Nitrosococcus watsoni C-113]
    MPKVEMYATLRCPYCIGARRLLDSKGIDYTEIRVDLEPEQRAIMINKSHRRTVPQIFINDQPIGGYDELAQLEQTRELDV
    LLGLA

    >gi|300112823|ref|YP_003759398.1| dihydrolipoamide dehydrogenase [Nitrosococcus watsoni C-113]
    MSNSYDVVIIGAGPAGYTAAIRCAQLGLRTACIDKWIAADGRPSLGGTCLNAGCISSKALLDSSELYRRAQREFAEHGIK
    VEQAGVDVAAMQARKDRLVHRLTANIAVLFEDHQIKWLSGHGRLLEDNQVEFTPHELDRSEILAANNVILASGSQPMELG
    AAPIDGERVVDSTGALSFQEVPQRLGIIGAGVIGVELGSVWARLGAKVTLLEAQATLLPIADITISQEAYKQFKQQGLDI
    RLGARVVSTRAGSKQVTVCYRIGEQEYELRVDKLIVAVGRQPCLDNLFTLETGLLLDERGFIDVDEYGATNLPGVYAVGD
    VVRGPMLAHKGSQEGIAVAEIIAEGKETVVKRSSIPWVIYTEPEIAWAGRTEQALRDADIDVRVGTFYFADSARANVMGS
    TKGLVKMVADAKTDQILGVHIIGPWASELIAEAVLAMEFAASSEDLARTIHAYPSLAEALHEAALDVDNRALHKVGRKKA


    >gi|300112906|ref|YP_003759481.1| arsenate reductase [Nitrosococcus watsoni C-113]
    MSQVSIYHNPRCSKSRQTLQLLREQGIEPVIIEYLKSPPTPAQLSEILQLLDKQPRDLMRQKEAEYEDNGLDNPSLSREQ
    LIAAMLAYPILIERPIVLANGKAAIGRPPEKVLEIL

    >gi|300112911|ref|YP_003759486.1| rhodanese domain-containing protein [Nitrosococcus watsoni C-113]
    MTIFSLLLQPDELARRLDKKNLLLIDLGNEESYLAHHVPGAVHLDYTHIVAARPPVMGLLPDEHRLSRVLSQLGFTPASH
    VIAYDAEGNGRASRFLWTLEELGHERFSLLDGGLKAWLAEGYPVEEGRQSRQPSHFHGHYQGNKAIDKEYILAHLSDPKV
    VILDARSPAEYHGEYVRAQRGGHIPGAVNFEWTQAIDQERNLRFKPMEELRSSLEALGITPDKEIICH
    CQTHHRSAHTCM
    VLKYLGYPKIKGYPGSWSEWGNDPDTPIEV

    >gi|300113106|ref|YP_003759681.1| Glutathione S-transferase domain-containing protein [Nitrosococcus watsoni C-113]
    MALSPGKRSVAALFSDPLCPFCHRTRIVIAEKNISADIIDIDPANLPEDLVRLNPHNSAPTLVARDLVLYDSRVIMEYFD
    ERFPHPPLMPVDPISRARIRLMLHRIDQDWYRLLGGTKTHRPNISSKTRKMLIEDLTILSPAFEKTPFFMNEEFSLLDCA
    LAPLLWRLLALETELPLQAKLVGDYANRIFARNSFQQSLSAAERAMQTKATSTLSSNGR

    >gi|300113229|ref|YP_003759804.1| disulfide bond formation protein dsbB [Nitrosococcus watsoni C-113]
    MRLSVRWVFFLGFFLCALMLAIAGYFQFVEDLEPCPLCILSRVVVLAIGGIFLVAALHNPRSWGVKIYALLGFVVTLIGI
    GVTGRHVWLQNLPADQVPA
    CGPGLNFMLDNFPLTETLELVFRGSGECAEVQWSFLGLTIPGWTLAAFLLLGVISLWQMGR
    AGSGVEKLT

    >gi|300113245|ref|YP_003759820.1| thioredoxin [Nitrosococcus watsoni C-113]
    MTDRIIPVTVTDATFEEEVLKSEQPALVDYWAEWCGPCKTVAPILEEIANDYQGKIKICKLNIDENPSTPPRYGIRGIPT
    LMLFKNGNVEATKVGALSKSQLSAFIDSNL

    >gi|300113281|ref|YP_003759856.1| hypothetical protein Nwat_0572 [Nitrosococcus watsoni C-113]
    MPNPSVKNHLQGQTSPYLLQHVDNPVAWYPWGEEALVRAQGEDKPILLSIGYSACHWCHVMAHESFENPETAAVMNEHFI
    NIKVDREERPDLDQIYQLAQQMLTGRPGGWPLTMFLEPVKQAPFFGGTYFPPEERHGLPGFKDLLQRVAEYFHTRREVIQ
    SQNERLLDAFEKLDGRSSAAEVEGLNRAPLQAAHQQLAQAFDSRYGGFRGAPKFPNPSIIERCLRDAHGEHITEDEKQQA
    LTMARLTLEQMAQGGIYDQLGGGFCRYSVDEKWRIPHFEKMLYDNGQLLVLYRDAYRLWGNGIFRRILEETGHWVVREMQ
    SPEGGYYSSLDADSEGHEGKFYVWTREQVRALLDDEKYTLAVRYFSLDQPANFEGHWHLYAAMTPEALAEEMKVPAPGLQ
    EQLTAAKQKLFAAREARIRPGRDDKILTAWNSLMIKGMAAAGQALAQPVFIASAEKAVDFVRAHLWQKGRLLVSYKDGRA
    QHQGYLDDYAFLLDALLELLQVRWRDGDLAFAVDLAEAVLGHFEDKAQGGFYFTADDHETLIHRPVPLMDNATPAGNGIL
    AWSLLRLGHLLGEMRYLKAAENTLKAAWESLQQTPHAHCSLLKALEEWLTPPQIVILRGSGEELESWRAVAAAAYAPRRV
    TLAIPLEAQYLPGILGEYWPQEAAVTAYVCSGHTCSAPLTQREALKEHLAAQGR

    >gi|300113288|ref|YP_003759863.1| DSBA oxidoreductase [Nitrosococcus watsoni C-113]
    MLRFVSGLLLAFSLLLLSPLGAAAEPTFTEGVHYKKVSPPLHAMEPGRAEVLEIFWYGCPHCYRFEPILEQWAENKPEDV
    DFIRVPAVFRDSWQLHAQAFYTAEALGVLDKVHRPLFDAMHLEGRQFKTKEALADFFATLGVPKKDFLPTFESFAVQGKV
    QQAIATTRASGITGVPAIVINGKYRTDANMAGGFEQMLEVADYLTAQGKTSSNQTTTTTE

    >gi|300113310|ref|YP_003759885.1| alkyl hydroperoxide reductase/thiol specific antioxidant/ Mal allergen [Nitrosococcus watsoni C-113]
    MSEVTIGKAVPDFELPATSGQTIKLSQLQGQNVVLYFYPKDDTPGCTQEGQDFRDLHSAFKRLNAVILGISRDTLTSHEA
    FKAQQHFPFELLSDKDEKVCRLFDVIKPKKMFGKDVKGIERSTFLIDQEGILRKEWRKVKVEDHAAEVLATVKTL

    >gi|300113412|ref|YP_003759987.1| glutaredoxin-like protein [Nitrosococcus watsoni C-113]
    MDTMEQIKQAVESNSIILFMKGSPQFPQCGFSGRTVQALQACGTEFAYIDVLANPEVRALLPQYSNWPTFPQLYINGELV
    GGCDIIMELFESGELQTKVQEAVPHTSEEG

    >gi|300113445|ref|YP_003760020.1| alkyl hydroperoxide reductase/thiol specific antioxidant/ Mal allergen [Nitrosococcus watsoni C-113]
    MSILVTQVAPDFSAPAVMADGTIKENFRLSDMRGKYVVLFFYPLDFTFVCPSEILAHNNRLEDFKERGVEVIGVSVDSQY
    SHYAWRNTPVANGGIGAIGFPLVADLNHDITRAYGVEHPDGVALRASFLIDKNGVVQHQVVNNLPLGRAVEEMLRVVDAL
    QFTEEHGEVCPAGWRKGEEAIRPDAEGVAEYLSKHASAL

    >gi|300113485|ref|YP_003760060.1| methyltransferase type 11 [Nitrosococcus watsoni C-113]
    MSQQASVLERYSEGAQARQVGLCCAVEYDSRSLRILPQEIIDKDYGCGDPSLYVREGDVVLDLGSGGGKVCYIAAQLVGN
    KGRVIGVDMNDDMLALARKYQAEMAKRLGSDRVGFKKGLLQDLALDLSAVDAYLSANPVSGSQDLARLEAFKARQRKESP
    LIPNASVDLVISNCVLNLVDEGAKAQMVAEIFRVLRPGGRVAISDIISDEEVPQHLRNDPKLWSG
    CISGAFQEKAFLDAF
    VAAGFMAVSYDKWESQPWQVVEGIEFRSVTLTAVKLEGVECMDRGQAVIYKGPYTQVYDEEGHVFPRGERIAV
    CERTFYF
    LTMGPYKDDFIGISPVALQEPTPWCAPAGTLRPARETKGGVHKGSSGAGASCCS

    >gi|300113508|ref|YP_003760083.1| periplasmic protein thiol/disulfide oxidoreductase DsbE [Nitrosococcus watsoni C-113]
    MLRYTIPLIVFTGLVLFFAVGLQRDPRQVPSPFIGKPAPELGVPQLRTPDKEIYRSDLLGKPALINVWASWCVACRAEHE
    VLIRLARETQLPIIGLNYKDERGAALQWLANLGDPYTAIAVDTDGQVGIEWGVYGVPESFLLDPKGVIRYKQIGPLTWKV
    VEDKLFPLIQSFGTQGG

    >gi|300113519|ref|YP_003760094.1| OsmC family protein [Nitrosococcus watsoni C-113]
    MKARIKWIEESSFTGQSGSGHTIVMDGPPESGGHNRGVRPMEMLLLGLGGCTAFDVVQILQKSRQSITDCVVEIAAKRAE
    SIPKVFTHIHVHFKVSGHELKEHHVQRAIKLSSEKYCSASIMLGKAASISHDYEIIDID

    >gi|300113669|ref|YP_003760244.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Nitrosococcus watsoni C-113]
    MAEPYVIKMPQLSDTMTEGVLVSWEKEIGEFIERGTVVATVETDKAIMDVEVFREGYLSGPQLPVDGVVAVGEPIAYLVA
    EAEQVVSTEADSSPKPAPEVDEPPKFEPAGASKPKTRIPAMPEGATPAPHPSHTRATPYARQLAGAHGIDLAGIKGSGSA
    GVIVAADVVSEEGTKGVARRIFKLPGAGRPMDSMEKAIAHNMEYSLSMPLFRATVYVDPSRLVAAAKKQGSSVTVVLAKA
    AALAIEKHPKINSVYQHEDRILEREQIDVGLAVATEGMGLVVPVLRDASQRDIADLNASWIDLVERARIKRLKPEEYSNP
    TFVISNMGMLGVAYFDAIPSPGTSAILAIATTGPQGMPVTITADHRIVNGADAARFLNTFKERVEHPEAWISSSGGTVPA
    SKQSPKAPLPLEGDWDYDVVVIGAGPGGEDCARELVEHGLKVALINDSPLPGGE
    CLWRGCIPSKTWRAAADRIRDRAHDA
    RLGVEGTASTALNWKTLKATRHQLLQSRGEMALKADKGMKIKFIQGHARFADEHHVEVVTAGNSDDPFSRTQPGSDSPSQ
    KISFAGAVIATGAPPFIPPIPGAQEGLRGGGVLTSDTVWGLEQIPKRLAVIGGGAIGVEMAQIFQDFGTEVLLLEAQDRL
    LAEVEPEVGKLLAGVLNADPRLTVQTSARVQAISGQPGAMEVSFTDGGGTSHRLEVDRVIMATGKRPHLEPLALDQAGVA
    TENGAIRVDAQCATSKPHIFAVGDVIGGLMLAHTAAQQGRVAAATMLGEAHAYELEKDCGVIFTRPQAAFVGLSVAQAKE
    RGMDAVEVKMPVRIDAKAMINNETEGLIKIVADKASHRIIGVHFLADHADTLIGEAVMMVAGNMTLEQTARAIHPHPTQT
    EMFGEMARRLLSRLRRTQRR

    >gi|300113705|ref|YP_003760280.1| peptide methionine sulfoxide reductase [Nitrosococcus watsoni C-113]
    MFKIHPKIEIPAAEEALPGRAEKMPVPQQHYVNGHPLMPPFPEGMEQALFGMGCFWGAERKFWQTEGVYTSAVGYAGGHT
    PNPTYEQVCTGMTGHAEAVWVVYDPKVISYPSLLKIFWESHDPTQGMRQGNDAGTQYRSAIYTYNNAQETAAEDSRKSYE
    KRLREAGYPPITTEISPAPEFYYAESYHQQYLAKNPGGYCGLGGTGIACPAPLEI

    >gi|300113790|ref|YP_003760365.1| redoxin domain-containing protein [Nitrosococcus watsoni C-113]
    MNKPRLVFFYLLLVAISAVPTAMAAEISQQAPDCVLKPFEKAGEVTLPQWQGKVVYVDFWASWCPPCLKSFPFLNDLHQR
    FSDQGLHIVGINVDEKLSDAQDFLARVPARFEIVVDPDQQCARSFDIQAMPSSFLIDRKGVIRHIHLGFRSGDTQELEAW
    TQKLLQEDTANP

    >gi|300113824|ref|YP_003760399.1| dihydrolipoamide dehydrogenase [Nitrosococcus watsoni C-113]
    MANEVEATQLAIIGGGPGGYAAAFLAADLGLEVTLIDGEPNPGGVCLYRGCIPSKALLHVAKVIGESREASAWGIHFPEP
    KIELDKLRSWKEQVVRKLTGGLGQLSRQRKINYIQGRAGFKDARTLEIKKQEGGAQLRFQNAILATGSYPASLLPHLSLD
    SPRLLDSTSALEIQDIPKTLLVVGAGYIGLEMATVYASLGSQVTVVEMTKGVLPGADRDLASVLAKRLEGVLHNLLFKTK
    VTRMEEEAKGIRVHLEGAEEGEHLFDKVLVAVGRKPNSAIPGLEHTQVELNDKGFIQVNAQRQTADSAIFAIGDVVGEPM
    LAHKASHEGRIAAEVIAGRRVFFEPRAIPAVVFTDPEVAWCGLTETEAKAEGQAIQVARFPWAASGRAVTLDRTDGLTKL
    IIDPETERVLGAGIVGPGAGELIAELVLAVEMAAVASDIKLSIHPHPTLSETVMEAAEVFFGQSTHLYRPAKK

    >gi|300113870|ref|YP_003760445.1| peroxidase [Nitrosococcus watsoni C-113]
    MALHIGDVAPDFTQESTIGPLHFHDWIGNSWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGW
    ISDINETQGCQVNFPIIADADRKVSEFYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLT
    DNYSVATPVDWKDGDDCVIVPSLKDPEVLKEKFPKGYKEIKPYLRMTPQPNK

    >gi|300113884|ref|YP_003760459.1| redoxin domain-containing protein [Nitrosococcus watsoni C-113]
    MHRIEYAPDATFKTRVRDESIEGSNPYRWQDITSKEIFTGKKVIVFSLPGAFTPTCSSNHLPRYEELYDEFKAMGIDEIY
    CLSVNDAFVMFQWSRHIEAKKVKMLPDGNGEFTRKMGMLVDKSNLGFGMRAWRYSMLVDDGKIEELFVEPDFSDNCPTDP
    FQVSDADTMLAALKGEETTEVSEPRRAFVG

    >gi|300113922|ref|YP_003760497.1| alkyl hydroperoxide reductase/thiol specific antioxidant/ Mal allergen [Nitrosococcus watsoni C-113]
    MRASGTLAPEWKVAQWFNTQQPLQLADLRGKVVVMHAFQMLCPGCVVHGLPQTQKIYNVFDANEVVVVGLHTVFEHHEVM
    TPQALEVFIHEYRYTFPIGVDQPDGQSGLPLTMRAYGMQGTPSLILIDHKGRLRKHSFGRDDDIQVGADIATLISEAKAA
    PLAEAENAGGNAGCDEDKCTA

    >gi|300114005|ref|YP_003760580.1| peptide methionine sulfoxide reductase [Nitrosococcus watsoni C-113]
    MIEKTKTLRKHFLTHSLMMLCLVVIIGLDPALALAAEKTSAKATFAGGCFWCMEPPFDKLEGVISTTSGYIGGHMKNPTY
    ETVSGGKTGHAEAVQISYDPNQISYAELLAIFWRNIDPLAANRQFCDHGSQYRSAIFYHNETQQRLAEESKAQLAQSGRF
    NQPIVTEIKSATPFYPAEAYHQNYYQKNPIRYKLYRFGCGRDQRLQELWGDSN

    >gi|300114133|ref|YP_003760708.1| iron-sulfur cluster assembly accessory protein [Nitrosococcus watsoni C-113]
    MAITVTASALKQIKKVLSQQENVEGLRVGVKKSGCSGYAYVLDFAKQVKSEDTVFNHDGVKILVDKQSLNFIDGTELDYR
    REGLNESFKFQNPNVTGTCGCGESFSM

    >gi|300114167|ref|YP_003760742.1| glutathione-disulfide reductase [Nitrosococcus watsoni C-113]
    MTTPYDFDLFVIGAGSGGVRAARMAAGFGARVAIAEERYLGGTCVNVGCIPKKLLLYAAHFSDDFEDATGFGWTVGQRQF
    DWSTLIQNKNAEIQRLNQIYENLLSKAGVTLINGRARLETPHTVSVNNHHYTAERILVATGGWPVVPEFPGREHVITSNE
    AFFLDKLPERVAIVGGGYIAVEFASIFNGLGSNTTLLYRGPLFLRGFDEDLRRNLAQEMSKRGVELCFNTQVVAVDKGVQ
    GFTVKRHDGKTMEVDALMYATGRAPNTLGLGLEEMRVELSWNGAVVVNEYYQSSIPSIYGIGDVTHRLNLTPVALAEAMV
    LARNLYGGEYSRLDYANIPACIFSHPNVATVGFTEEQAREHCGEISIYRSDFRPLKHTLSGRDERTMVKLIVEKATDRVV
    GAHMLGPDAGEIIQGIAIAIKAGAAKSIFDNTLGIHPTAAEEFVTLRQPVTGL

    >gi|300114414|ref|YP_003760989.1| rhodanese domain-containing protein [Nitrosococcus watsoni C-113]
    MIFRQLFDPESSTYTYLIGDPATKEAVFIDPVNTRVDEYLNLLNKYALKLKYSLETHAHADHITASGLLRQRTGAKTGIG
    QACGAQYADYQLKDGVVLAFGQGEEIKVLATPGHTPGSVSYLWRDRVFTGDALLINGCGRTDFQGGDPGVLYDSITQKLF
    TLPGETIVYPGHDYNGRWVSSIEQERTRNGRLAGKTRSEFIEIMNNLNLPKPQRIDEAVPANRRCGLTEEEIRQDTMMMG
    EKRVSTPQDLVQEARKQVREIDVATVKQRLGDGKTAIIDVREPEEFAAGHLPGAINVPRGVLEFRLGNTAELADPNVPIM
    LY
    CQTGGRAALAAWSLKCLGYTDAVLIAGGYDAWRAAEQNAN

    >gi|300114451|ref|YP_003761026.1| electron transport complex RnfABCDGE type subunit E [Nitrosococcus watsoni C-113]
    MAPPPVSYSQISRAGLWNNNVALVQLLGLCPLLAVTGTVINGLGLGLATLLTLVASNSLVALIRHWVPKEVRLPVFVLII
    ASIVTTIELLMNAYFYDLYKVLGIFIPLIVTN
    CAIIGRAEAFASRQKVGRAFTDGLMMGLGFTLVLMLLGGLREALGQGT
    LLDQAHLMFGEAARDLKLTLVEDYRGFLLAILPPGAFIGLGLLIALKNVIDRRLAQRTAVQKSHATKPIDVLPERI

    >gi|300114522|ref|YP_003761097.1| hypothetical protein Nwat_1936 [Nitrosococcus watsoni C-113]
    MSNKVEIQYCTGCRWLLRAAWIAQELLTTFEQEISELTLRPGTGGVFNILANGKLVWSRKEAGRFPEITELKRLVRNQIA
    PTKDLGHADKKHK

    >gi|300114557|ref|YP_003761132.1| cytochrome c biogenesis protein transmembrane region [Nitrosococcus watsoni C-113]
    MRIFLALALILLGNTSATAGLLDRLGFGETEKPPLLKVDQAFIYNAAVEDGNTIMARVNIVEGYYLYRDKFAFQILDAQG
    VKISTVKLPSGKIKEDPFFGATEVYEGKTELQIPISLNRQGTTPETVTLETSLQGCSEIHGICYPPATQKISLELPSPSI
    DERGSVAADSDLTPGQTPTTALSTQDRIVQTLFNDQIWLTLAAFFGFGLLLSFTPCVFPMIPILSGIIVGQGKNITTWRS
    FMLSLAYVLAMALTYTVAGIVASLLGENLQATFQHPGILIGASLVFVLLALSMFDLYHIQLPTRLQTRLLHLSQKQKGGT
    LLGAGLMGLFSALIVGPCVAPPLAGALIYIGESGDALLGGSALFALSMGMGTPLLFLGASAGKLLPHAGSWMQPIKYLFG
    VLLLAVAIWLLSRILPQAIIMLLWGALFIIGAVYLGALETLGPDTTGWSRLWKGTGLISLIYGTLLIIGAASGGGTEWQP
    LRGLTVASSANTPTSSAESLNFQPVKGIQGLQLALQGAEERLVMLDFYADW
    CVDCKRMEATTFSDPTVKNALRNTLLLQT
    DVTAYDDQDKALLNQLSLYGPPSILFFGPDGKELRQVRLIGQASPEEFLRHLQQVNALLAQKTPKGA

    >gi|300114558|ref|YP_003761133.1| alkyl hydroperoxide reductase/thiol specific antioxidant/ Mal allergen [Nitrosococcus watsoni C-113]
    MNKIIRWPLILTAALLAGIGGYILYQAQQDARPTTGPIRPVFKLPDVNGTEHDIREWDGKVVVINFWATWCPPCLEEIPE
    FIELQHSLGEQGLQFIGVAIDRPDKVKTFIKEHGINYPILVSEEKAPRVAMDYGNELDVVPYTAFINRAGQVVYTHAGVL
    DKETTKSYILPLL

    >gi|300114569|ref|YP_003761144.1| iron-sulfur cluster assembly accessory protein [Nitrosococcus watsoni C-113]
    MNATNAMLNSLIFTDTAAGKVKELIKEEGNEKLMLRVFITGGGCSGFQYGFTFDEASHEGDTQVKNGGVTLLIDPTSYQY
    LVGAEIDYTEGLEGAQFVIRNPNAETTCGCGSSFSP

    >gi|300114625|ref|YP_003761200.1| alkyl hydroperoxide reductase/thiol specific antioxidant/ Mal allergen [Nitrosococcus watsoni C-113]
    MARTESIMLDLGTQAPDFQLLEPATGRTVSLADFKGASGLLIIFMCNHCPYVKHISTALSQFAREYQPKGLAIAGISVND
    VENYPDDSPEKMAEEVEAQGYIFPYLYDETQEIAKAYKAACTPDFFLFDKNHKLVYRGQFDASRPGNDAPIAGEDLRAAA
    DAVLAGQPISGEQRPSMGCNIKWKPGNEPDYFG

    >gi|300114630|ref|YP_003761205.1| methionine-R-sulfoxide reductase [Nitrosococcus watsoni C-113]
    MKRIPILPLMLALLISNTIFAGNSEKEGFNENAFNKPSLEEIKAILTPQQYQVTQEEETESSFNNAYWNNKKAGIYVDVI
    SGEPLFSSTDKYASGTGWPSFTNPINKKYIVTKDDWSFFMKRTEVRSKYADSHLGHIFNDGPPPTGLRY
    CINSAALRFIP
    IEKMREEGYKKYLTLFDKEGVK

    >gi|300114646|ref|YP_003761221.1| electron transport complex RnfABCDGE type subunit A [Nitrosococcus watsoni C-113]
    MSEYALILVSTVLVNNFVLVKFLGLCPFMGVSRKLETAIGMGLATTFVLTLSSVCSYLINEYLLMPLGIEYLRTIAFILA
    IAFVVQFTEMVVHKTSPLLYQVLGIFLPLITTN
    CAVLGVALLNIQHQHSFLSSALYGFGAAVGFSLVLILFAALRERIAA
    AEVPQPFQGPAIGLITAGLMSMAFMGFAGLVKG

    >gi|300114649|ref|YP_003761224.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Nitrosococcus watsoni C-113]
    MFSIKRLIFIFLILTLIGAFFHFGGPQYLDLERLKAHQEQLQQMIAGAPVVSVSIFFISYVLVAALSLPGAAVMTIAGGA
    LFGLTAGTVIVSFASTLGATLAFLSSRFLFRDSLRQRYDKTVQRVDERIAVDGPFYLASLRLVPVFPFFVINIVMGLTGI
    PIWRFYWVSQLTMLPGTLVYVNAGTQLAAIQKVGDILSLPLLLSFLLLALFPLIAKFLLALFKRARLYKRFTKPKHFDYN
    LLVIGAGSAGLVSAYMGATVKAKVALIERDKMGGD
    CLNTGCIPSKALIKSSRIAEAMRQADRYGLPANNPPIPFAPVMER
    VQKIIKQIEPHDSVERYTRLGVNCLQGEARLISPWEVEIKAANGSTRRVTTKATIIATGGHPFVPSIEGMGEIRPLTSDT
    VWQLRKLPQRLLVLGGGPIGCELAQAFARLGSQVTLVEMGERLLLQEDPDASAAILECFREEGITVKLRHKAIRFAIEGG
    EKVAYCAHPEGELRISFDQVLVAVGRTANTEHLGLENLGLSTSKGGALPVEEDMSVGYPNLFACGDVTGLYQFTHVAAHQ
    AWFAAVNALFGHFKRFKVDYSVIPWVTFTSPEVGRVGLNEIEAKKQGMDYEVTRYGLKDLDRAIAESEAYGYIKVLTPPG
    KDRILGVTVVAPHGAELLAEFILAMKHKIGLNKILGTIHPYPTWNEAVKFTAGEWKKAHAPEKILRWLERFHRWRLG

    >gi|300114650|ref|YP_003761225.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Nitrosococcus watsoni C-113]
    MTPVSTKNNFDVLVLGGGTAGTNAAQAACNAGASRVGVVYIPEMFNTCVQEGCMPSKSVLASSAQGHSFLEAIYRKDVHL
    SRLARALKGKMQRAPYTLIEGKARFLPEAGVEVTQGEKTRRLWAKNYVIATGSHAWIPPIKGLEDLPAGRMLVSDDIVGI
    QTLLGEAPKRLLVLGGGPIGLELATFFARLGTEVLILDTSGLLGPFDSEFGQARLRALKTTPHMDSLVPGELQSVTDTAS
    GLLCRIAHQGTLLERYADRLLIATGRKPNIEALALENADVQVEGSTIEHNEYLQTSNPHIYIAGDVINHHQILHYAAEMG
    QIAGANAARGKPTAAMDYQKFSLAITFDEYPSALIGLTEKEAKAQGYDVISATQDLSSLGMGILEDLRWGLWKLVADRKD
    GRVLGSQIFGPSSAPEIIQLLSPILYYQGTLKDIVRMTWYHPTYAELLRSLARKLCSETGIECPGA

    >gi|300114664|ref|YP_003761239.1| disulfide bond isomerase, dsbC/G-like protein [Nitrosococcus watsoni C-113]
    MGKKLLGFLLAGGLVTLSFTALGNEEIEAVRASLQKLVPGTEPQSIKPAPIPGIYEVVLEGQVFYLSQDGRYMVQGQLVD
    LATRTNLTEERLKVIRAAAISNLDEQDMIVFGPEQAKHTVNVFTDID
    CGYCRQLHQHIKEYNALGLKIRYLAFPRAGIGS
    SSYDKAVEVWCAKDPHQAMTQAKAGKPVENTAKCENPVADQFKLGQSLGVNATPTLMLEDGTVLPGLVRPQALVNILEQK
    VAAHP

    >gi|300114667|ref|YP_003761242.1| methylated-DNA/protein-cysteine methyltransferase [Nitrosococcus watsoni C-113]
    MVHSVYGAIVATPLGKLGLSTSENTLIGLDFLPLNTPECFPLDSAARAALAQLQAYFADPRVMFTLSLLPQGTVFQKRVW
    HALCLIPPGSTVTYGKFAEKLKTSPRAIGAACRTNPLPIFIP
    CHRVISSQGLGGYSGATEGPYLDIKAWLLRHEAKGGR

    >gi|300114980|ref|YP_003761555.1| hypothetical protein Nwat_2416 [Nitrosococcus watsoni C-113]
    MKHQDIGWHFDNTYAQLPDHFYTKLHPVPVHEPRLVIVNNVLAEELGLNFKASSEDELAQLFSGNQLPEGAEPLAQVYAG
    HQFGHFTYLGDGRAHLIGEHLTPDGKRVDIQFKGSGQTPYARRGDGRAALGPMLREYIISEAMHALGIPTTRSLAIATTG
    ESVYRETVLQGAILTRVASSHLRVGTFEYLAAQEDKAGLKQLTDYTIQRHYPEIIDSDTPYLELLKAVMACQIKLITEWL
    RVGFIHGVMNTDNMAVSCQTIDYGPCAFMDSYDPNTVFSSIDHMGRYAYANQPRIAQWNLARFAEAILPLLHENIEKATA
    MAEEAIQSFKALFQQEWLAMMRRKLGLFGEEKEDMEFINGLLQWMQRSHADYTNTFRDLMDEHFPEEPHYQDQEFKHWYD
    RWQQRLERNTKPFPSSLCLMGATNPVVIPRNHRVEAALNAVEQNADFSKLHELLDVLSEPYKDKEKYTEFKNPPAPKERV
    SQTF
    CGT

    >gi|300115035|ref|YP_003761610.1| thioredoxin [Nitrosococcus watsoni C-113]
    MSENNYIFDVTETNFAEQVLAKSHQAPVLVDFWAAWCQPCQMLMPLLKQLAESYQGQFWLAKVNADEAQSLTHQYGVRGL
    PTLKLFRHGEVVEELVGVQPESAIRAAIDRHLIRESDRLLEQAQTARATGQKERSLELLHRAAEIDPKNQRVSLTLAETL
    LQQGEIAEAEQILTALPREIREEEPASGLLAQIEFTALASHAPDIALLKQRLKASPEDSEARYLLGVQQAFSRDYQGALE
    QFLDLLKRDPKYGDSAARKALLAVFNILGSDHELVPHYRRQMFRCLH

    >gi|300115045|ref|YP_003761620.1| rhodanese domain-containing protein [Nitrosococcus watsoni C-113]
    MSYSTMISPAELAQVLGKPNWVIFDCRFNLMDSSAGWYAYQRDHIPGACYVHLEEDLSDPVTPGSGRHPLPKPERLADKL
    GGWGVDSTTQVVVYDDAAGAFAARLWWLLRWLGHKAVAVLDGGEHRWREEGYPLNSIVPEPAPARFEGQVQPSMTITVED
    VEHASLLGYLLLDGRAPERFRGEFEPVDRVAGHIPGAKNHPFQQNLDEQGRFLPSQELAGAFRKQMGEVPSEQVVCM
    CGS
    GVTACHNLLAMEIAGFQGARLYPGSWSQWITDGTRPVATGDETHD

    >gi|300115253|ref|YP_003761828.1| UBA/THIF-type NAD/FAD-binding protein [Nitrosococcus watsoni C-113]
    MNDQQLLRYSRQILLPQIDIEGQQKLLDSRVLVVGVGGLGSPIALYLAGAGVGRLTLVDPDEVELSNLQRQILHDGNVIG
    LPKVESARRRLQALNPEVEVRAIAARLEGKGLEAAVAQADVIVDGSDNFATRFALNIACVRIGRPLVSGAAIRMEGQVAV
    FDSRQPDGACYHCLFREDEKSEEES
    CSQTGVLAPLLGIIGSVQAMEALKLLLGIGQSLHNRLLLLDGLNMRWREIRIHQD
    PQCPICNGPQKKWRALA

    >gi|300115270|ref|YP_003761845.1| thioredoxin reductase [Nitrosococcus watsoni C-113]
    MSKIKHCRLLILGSGPAGYTAAVYAARAALEPVLITGVEQGGQLMTTTDVDNWPGDDQGVQGPELMERMRKHAERFGTEV
    ILEHINEVDFSQLPFLLKGDTDHYTADALIIATGASAQYLGLPSEGAYMGRGVSA
    CATCDGFFYRGKPVAVIGGGNTAVE
    EALYLSNMADHVTVVHRRDRFRAEKILANRLLQKAAKGNVTIEWNHVLEEVLGDEAGVTGIRIKEVDTNQTKKLPLHGVF
    IAIGHKPNTDIFTGQLAMEQGYIQVRGGFKGFATQTSVQGVFAAGDVIDPTYRQAVTSAGTGCMAALDAEKYLDGLEEQ

    >gi|300115320|ref|YP_003761895.1| methionine-R-sulfoxide reductase [Nitrosococcus watsoni C-113]
    MGKIHKTEAEWKAQLTPEQYRVTREAGTEPAFSGKYYHHQEEGTYCCVCCGSPLFSSEQKYESGSGWPSFWNPIDSQALE
    KHSDDSHGMSRIEVRCARCDAHLGHVFGDGPAPTGQRY
    CINSDALDFEIDSPSI

    >gi|300115402|ref|YP_003761977.1| heavy metal translocating P-type ATPase [Nitrosococcus watsoni C-113]
    MLEISRLTTDQESSPAPPLKKAAQTLVLPIKGMTCATCSTRLERVLNKILGVVKSQVNLASEQANITFDPQQTSPQRFYQ
    AITQAGFSVPLEGMEFHIGGMT
    CATCSTRLEKVFSRLTGVSEVTVNLATERALLKAPAGMLPPAAVIAAAQRAGFTATPL
    SNQSEKRNQDETEKIAEEQREWNQLLLAILLTLPLALPMLLMPFDIHADLPAGIQFLLATPVQFWVGRRFYKGAYRSLRG
    GSANMDVLVVLGTSAAWGLSTWNTLVPGTGSDLYFEASAMVMTLILLGKRLEGRAKRSAASAIRALMALQPGIARIEREG
    KILEVPIEQVAKGNSVLVRAGERVPVDGVILEGYSQLDESLITGESLPVSRGEGETITGGSINGGGLLRVRATTVGAEST
    LARIIRLVEDAQASKAPVQKLVDRVAHVFVPVVVALALLTFAGWWWLEGSTDTAFIAAISVLVIACPCALGLATPTALMV
    GTGVAARYGILIRDAVALERAQNTNTVVFDKTGTLTEGQPTLVEILAVGGISEETLLQWVASAQQGSEHSLAKAVLAKAQ
    GLPLHPPRDFHSLPGRGLRAQVQDRTLIIGNLRLMREHQVDVTSLSVRAQGLEESGHTLMWVAEINSAAPLLGVLAVTDP
    IKKTAPQAIAALRAQGLTTMILSGDNPRAAQAVADKVGIDQVIAEVLPEDKAAHIQALRTKGCHVAMIGDGVNDAPALAA
    ADVGMAMGTGTDVAMEAAGITLMRGEPTLVAAALSISQATYHKIRQNLFWAFIYNVIAIPLAASGMLSPVIAGAAMALSS
    VSVVSNSLLLRRWQPEN

    >gi|300115403|ref|YP_003761978.1| heavy metal transport/detoxification protein [Nitrosococcus watsoni C-113]
    MEKTYKVEGMTCGACAQSVEKAISGVAPTATVKVDLENNQVTVTGVEDDNLVAQAVEDAGFDYEGPVF