Nitrosococcus oceani ATCC 19707 uid58403

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|77163536|ref|YP_342062.1| hypothetical protein Noc_A0019 [Nitrosococcus oceani ATCC 19707]
    MTRTPQSRLKVWRPMPSSTAMKHQDIGWHFDNTYAQLPDHFYTKLHPVPVHEPRLVIVNNALAEELGLNLKASSEDELAQ
    LFSGNQLPEGAEPLAQAYAGHQFGHFTYLGDGRAHLIGEHLTPDGKRVDIQFKGSGQTPYARRGDGRAALGPMLREYIIS
    EAMHALGIPTTRSLAIATTGESVYRETVLQGAILTRVASSHLRVGTFEYLAAQEDKAGLKQLTDYAIQRHYPEIIDSDTP
    YLELLKAVMACQIKLITEWLRVGFIHGVMNTDNMAVSCQTIDYGPCAFMDSYDPNTVFSSIDHMGRYAYANQPRIAQWNL
    ARFAEAILPLLHENIEKAAAMAEEVIQSFKALFQQEWLAMMRRKLGLFGEEKEDREFITGLLQWMQRSHADYTNTFRDLM
    DEHFPEEPHYQDQEFKHWYDRWQQRLEHNTNPFPSSLCLMGATNPVVIPRNHRVEAALNAVEQNADFSKLHELLDVLSEP
    YKDKEKYTEFKNPPAPKERVYQTF
    CGT

    >gi|77163580|ref|YP_342105.1| glutaredoxin GrxC [Nitrosococcus oceani ATCC 19707]
    MPKVVMYATLWCPYCIGARRLLDSKGIDYTEIRVDLEPEQRAVMINKSHRRTVPQIFINDQPIGGYDELAQLERARELDV
    LLGLA

    >gi|77163651|ref|YP_342176.1| dihydrolipoamide dehydrogenase [Nitrosococcus oceani ATCC 19707]
    MSERYDVVIIGAGPAGYTAAIRCAQLGLQTACIDKWIAADGRPALGGTCLNAGCISSKALLDSSELYQRAQKEFAEHGIK
    VEQAGVDVTAMQARKDRLVHRLTANIAALFEDRQIKWLPGHGRLLEDNRVEFTPHGLDRPEILAAKSVVLASGSQPMELG
    AAPIDGERVVDSTGALSFQEVPQRLGIIGAGVIGVELGSVWTRLGAKVTLLEAQDTLLPMADITISQEAYKQFKDQGLDI
    RLGARVVSTRVSSKQVTVCYRIGEKEYELEVDKLVVAVGRQPCLDNLFALEAGLLLDERGFIHVDEYGTTNLPGVYAVGD
    VVRGPMLAHKGSQEGIAVAETIAEGKKTAVKRNSIPWVIYTEPEIAWAGRTEQALRDADIDVRVGTFYFADSARANVMSG
    SKGLVKIIADAMTDQILGVHIIGPWASELIAEAVLAMEFAASSEDLARTIHAYPSLAEALHEAALDVDNRAIHKIGRKKE


    >gi|77163724|ref|YP_342249.1| arsenate reductase [Nitrosococcus oceani ATCC 19707]
    MSQVSIYHNPRCSKSRQTLQLLREQGIEPIIIEYLTSPPTSAQLSEILQLLDKNPRDLMRQKEAEYQDNGLDNPSLSQEQ
    LIAAMVAHPILIERPIVLANGKAAIGRPPEKVLEIL

    >gi|77163729|ref|YP_342254.1| thiosulfate sulfurtransferase [Nitrosococcus oceani ATCC 19707]
    MAMFSLLLQPDELVRRLDEKNLLLIDLGSEESYLARHVPGAVHLDYTHIVAARPPVMGLLPDEHRLSRVLSQLGFTPESH
    VVAYDAEGNGRASRLLWTLEELGHKHFSLLDGGLKAWLVEECPVKEGRESRQPSHFHGRYQGHQAADKEYILAHLLDPKV
    VILDARSPAEYHGEYVRAQRGGHIPGAVNFEWTQAIDQERNLRFKPMDELRSSLEALGITPDKEVICY
    CQTHHRSAHTCM
    VLKYLGYPKIKGYPGSWSEWGNAPDTPIKV

    >gi|77163740|ref|YP_342265.1| heavy metal translocating P-type ATPase [Nitrosococcus oceani ATCC 19707]
    MLEISRLTTDKESFSAVPSKEAAQTLVLPIKGMTCATCSTRLERVLNKVPGVVKSQVNLASEQAKIAFNPQQTSPQRFYQ
    AITQAGFSVPLEGMEFRIGGMT
    CATCSARLEKVFSRLAGVSKVTVNLATERALLKAPAGVLPPAAVIATAQQAGFTATLL
    SNRAEKGNQDEAEKIAEEQHEWNHLLLAILLTLPLALPMLLMPFGIHADLPAGIQFLLATPVQFWVGRRFYTGAYRSLRG
    GSANMDVLVILGTSAAWGLSTWNTLMPGAGSDLYFEASAMVITLILLGKRLEGRAKRSAASAIRALMALQPTVARIEQGE
    KILEVPIEQVAENDIVLVRAGERVPVDGVILEGHSQLDESLITGESLPVSRGEGETITGGSVNGEGLLRVRATTVGTEST
    LARIIRLVEDAQASKAPVQKLVDRVAHIFVPVVVTLALLTFAGWWWLAGSADTAFIAAVSVLVIACPCALGLATPTALMV
    GTGVAARYGILIRDAVALERAQDSNTVVFDKTGTLTEGQPAVTEILAVNISEETLLQWVASAQQGSEHPLAKAALAKAQG
    LPLQPPRNFRSLPGRGLRAQVQKRTLIVGNLRLMREYQVDFTSLSARAQILEESGHTLMWVAEIDSAAQLLGVLAVTDPI
    KNTAPQAVAALRARGLTTMMLTGDNPRVAQVVADKVGIDQVIAEVLPEDKAAHIQALRAKGCHVAMIGDGVNDAPALAAA
    DVGMAMGTGTDVAMEAAGITLMGGNPTLVAEALSISRATYGKIRQNLFWAFIYNVIAIPLAASGMLSPVVAGAAMALSSV
    SVVSNSLLLRRWRPGSQSIISSF

    >gi|77163830|ref|YP_342355.1| glutathione S-transferase-like protein [Nitrosococcus oceani ATCC 19707]
    MPLSPGKRSVTALFSDPLCPFCHRTRIVVAEKNISAEIIDIDPANLPEDLVRLNPHNSAPTLVARDLILYDSKVIMEYFD
    ERFPHPPLMPVDPISRARIRLMFYRIDQDWYRLLGGTKTHRSNISSKTRKMLIEDLTILSPTFEKTPFFMNEEFSLLDCA
    LAPLLWRLLALEAELPPQAKLVEDYANRMFARDSFQQSLSAAERAMRTKATSPI

    >gi|77163876|ref|YP_342401.1| thioredoxin reductase [Nitrosococcus oceani ATCC 19707]
    MSKIKHCRLLILGSGPAGYTAAVYAARAALEPVLITGVEQGGQLMTTTDVDNWPGDDQGVQGPELMERMRKHAERFGTKV
    ILEHINEVDFSQVPFLLKGDTDHYTADALIIATGASAKYLGLPSEGAYMGRGVSA
    CATCDGFFYRGKPVAVIGGGNTAVE
    EALYLSNMADHVTVIHRRDRFRAEKILANRLLQKAAEGNVTIEWNHTLEEVLGDEAGVTGIRIREVDTNQTKKLPLHGVF
    IAIGHKPNTDIFTGQLEMEHGYIQVRGGFKGFATQTSVRGVFAAGDVIDPTYRQAVTSAGTGCMAALDADKYLDGLEER

    >gi|77163893|ref|YP_342418.1| adenylyltransferase [Nitrosococcus oceani ATCC 19707]
    MNDQQLLRYSRQILLPQIDIEGQQKLLDSRILVVGVGGLGSPIALYLAGAGVGQLTLVDPDEVELSNLQRQILHDSNVIG
    LPKVESARRRLQALNPEVEVRPIAARLEGKDLEAVIAQADVVVDGSDNFATRFALNIASARVGRPLVSGAAIRMEGQVAV
    FDSRQPDGACYHCLFQEGGENEEET
    CSQTGVLAPLLGIIGSVQAMETLKLLLGIGRSLHNRLLLLDGLSMRWRETRIQQD
    PQCPICNGSRERWRELA

    >gi|77164076|ref|YP_342601.1| DSBA oxidoreductase [Nitrosococcus oceani ATCC 19707]
    MLRFVSGLLLSFSLLLISPLGAAAEPAFTEGVHYKAVSPPLHAMEPGEAEVLEIFWYGCPHCYRFEPILEQWAENKPEDV
    AFIRVPAIFRDSWQLHAQAFYTAEALGVLDKVHRPLFDAMNLERRQFKTKEALADFFATLGVPKEDFLPTFDSFAVQGKV
    QQAIATTRASGITGVPAIVINGKYRTDANMAGGFEQMLEVADYLTDQGKTSSEQTATTTE

    >gi|77164110|ref|YP_342635.1| UbiE/COQ5 methyltransferase [Nitrosococcus oceani ATCC 19707]
    MHDVVQDYYGKQLQSSADLKTTACCDASAMPDWLKPLLARIHPEIQFRYYGCGLICPPLLKGCRVLDLGCGSGRDVYALA
    QLVGPEGKVVGVDMTDEQLAVAQSHQGWHTESFGFDNVSFIKGYIEKLDELDLEPGSFDVIVSNCVVNLSPDKAAVLDGV
    HRLLKPGGELYFSDVYSDRRVPDAVRNNSVLYGE
    CLGGALYWNDFLRLANAAGFADPRLVEDRSLEVTDRNLAQQTGNLQ
    FFSATYRLFKLDGLESACEDYGQAVIYQGTIPHSPHQFVLDKHHAIAAGRVFPV
    CGNTWRMLHETRFAGHFQFIGDFKRH
    FGLFEGCGSVMPFDTVAGTTEAIPCC

    >gi|77164113|ref|YP_342638.1| pyruvate/2-oxoglutarate dehydrogenase complex dihydrolipoamide dehydrogenase (E3) component and related enzyme [Nitrosococcus oceani ATCC 19707]
    MKKAYLLMVITALVVGFFFFDLDRLLTLEGLKQGLAQFEAWRTDQPMVIGGAFLLLYVLVTALSLPGAAVMTLAAGALFG
    LLWGTIIVSFASTVGATLAFLISRYLLHDTVQKRFGDRLKPINEGIKKDGAFYLFTLRLVPVFPFFLINLLMGLTPIRAL
    TFFWVSQVGMLAGTLVYVNAGTQLAQLDSLSGILSPSLLLSFALLGVFPLLAKKLLAVIKARRVYAGYQKPSHFDRNLIV
    IGAGAGGLVTAYIAAAVKAKVTLIEAHKMGGD
    CLNYGCVPSKALIKSAKLAHQMRQADHYGLEATSPHFSFRKVMARVHE
    VIRQVEPHDSIERYEGLGVEIIQGYARLVDPWTVEIKRNDGSVQQLTSRSIVLATGARPFIPPLPGIKEVGYVTSDTLWD
    EFAKLDEAPKRLVVLGGGPIGCELAQSFTRLGSQVTQVEMAPRILIREDEEVSEFAKASLQGDGVAVLTNHKALRCEKQG
    GTKRLIMEYEGVEKIIEFDTLLCAVGRVARLQGYGLEELGIETNRTIVTNDYLETLYPNIYAAGDVAGPYQFTHTAAHQA
    WYAAVNALFSQFKRFKVDYRIIPWTTFIDPEVAQVGLNEQEAKKKGIAFEVTRYGLEDLDRAITDGAAHGFVKVLTEPGK
    DRILGVTIVGKHGGDLMAEFVLAMKHGLGLSKILGTIHAYPTWAEANKYAAGEWKRAHAPERVLIWLEKYHQWRRGNAKT
    SPADGPATKHSDASDRLG

    >gi|77164114|ref|YP_342639.1| radical SAM domain-containing protein [Nitrosococcus oceani ATCC 19707]
    MHATLPLLEVTDFPPIRRKSLETLQVNLGYKCNQSCLHCHVNAGPNRKEMMDRDTLELIFPVLKSRPIKTLDLTGGAPEL
    HSDFRYLVSKARATGVHVIDRCNLTILFEPGQENLAEFLAKYQVEVVASLPCYSLENVDKQRGKGVFDKSIAGLQKLNTL
    GYGQPGSDLALNLVYNPQGPTLPPDQQSLEADYKRELRQHFGIEFNQLYALANMPIKRFGSTLISKGKFQGYMQLLKDSY
    QPNNLEQVMCRSLVSVDWQGYLYDCDFNQQLALPLGGVKRKHLRDLLEESLNDYPIRIADHCYGCTAGQGSS
    CGGSF

    >gi|77164117|ref|YP_342642.1| 3-mercaptopyruvate sulfurtransferase [Nitrosococcus oceani ATCC 19707]
    MSYSTIISPAELVEALGHPNWVIFDCRFNLMDSSAGWYAYQKGHIPGAYYVHLEEDLSSPVTPGSGRHPLPKPEQLADKL
    GGWGVDSTTQVVVYDDASGAFAARLWWLLRWLGHKAVAVLDGGEQRWREEGYPLNRATPEPAPACFEARLQPSMTTTVED
    VEHASLLGYLLLDGRAPERFRGDFEPVDRVAGHIPGAKNHPFQQNLNKQGRFLPSQELAGAFRKQMGEVPSAQVVCM
    CGS
    GVTACHNLLAMEIAGFQGARLYPGSWSQWITDGTRPVAMGDETHD

    >gi|77164127|ref|YP_342652.1| thioredoxin domain-containing protein [Nitrosococcus oceani ATCC 19707]
    MSENNYILDITEANFAEQVLTKSYQTPVLVDFWAAWCQPCQMLMPLLKQLAESYQGQFWLAKVNADEAQSLTHQYGVRGL
    PTLKLFRHSEVVEELVGVQPESAIRAAIDRHLIRESDLLLEQAQTARATGQEERSLELLHRAAEIDPKNHRISLTLAETL
    LKQGEIAEAEQILTTLPREIREEEPASGLLAQIEFTAFASRAPDIALLKQRLKTNPEDSEARYLLGVQQAFSRDYQGALE
    QFLDLLKRDPKYGDSAARKALLAVFSILGSDHELVPLYRRQMFRCLH

    >gi|77164212|ref|YP_342737.1| hypothetical protein Noc_0691 [Nitrosococcus oceani ATCC 19707]
    MTRTPQSRLKVWRPMPSSTAMKHQDIGWHFDNTYAQLPGHFYTKLHPVPVHEPRLVIVNNALAEELGLNFKASSEDELAQ
    LFSGNQLPEGAEPLAQAYAGHQFGHFTYLGDGRAHLIGEHLTPDGKRVDIQFKGSGQTPYARRGDGRAALGPMLREYIIS
    EAMHALGIPTTRSLAIATTGESVYRETVLQGAILTRVASSHLRVGTFEYLAAQEDKAGLKQLTDYAIQRHYPEIIDSDTP
    YLELLKAVMACQIKLITEWLRVGFIHGVMNTDNMAVSCQTIDYGPCAFMDNYDPNTVFSSIDHMGRYAYANQPRIAQWNL
    ARFAEAILPLLHENIEKAAAMAEEAIQSFKALFQQEWLAMMRRKLGLFGEEKEDMEFITGLLQWMQRSHADYTNTFRDLM
    DEHFPEEPHYQDQEFKHWYDRWQQRLEHNTKPFPSSLCLMGATNPVVIPRNHRVEAALNAVEQNADFSKLHELLDVLSEP
    YKDKEKYTEFKNPPAPKERVSQTF
    CGT

    >gi|77164396|ref|YP_342921.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nitrosococcus oceani ATCC 19707]
    MSVLVTQVAPDFSAPAVMADGTIKENFRLSDARGQYVVLFFYPLDFTFVCPSEILAHNNRLEDFKERGVEVIGVSVDSQY
    SHYAWRNTPVVDGGIGAIGFPLVADLSHDITRAYGVEHPDGVALRASFLIDKNGVVQHQVVNNLPLGRDVEEMLRVVDAL
    QFTEEHGEVCPAGWRKGEEAIRPDAEGVAEYLSKHASAL

    >gi|77164459|ref|YP_342984.1| periplasmic protein thiol-disulfide oxidoreductase DsbE [Nitrosococcus oceani ATCC 19707]
    MLRYTIPLIIFTALVLFFAVGLQRDPRQVPSPFIDKPAPELGVSQLRTPSKEIYRSDLLGKPALINVWASWCVACRAEHE
    VLMRLARETRLPIIGLNYKDERGAALQWLANLGDPYAAIAVDTDGQVGIEWGVYGVPESFLLDPEGVIRYKQIGPLTWKV
    VEDKLLPLIRSFETQGG

    >gi|77164469|ref|YP_342994.1| OsmC-like protein [Nitrosococcus oceani ATCC 19707]
    MKARIKWIEKSSFTGQSGSGHTIVMDGPPGNGGHNRGVRPMEMLLLGLGGCTAFDVVQILQKSRQPITDCVVEISAKRAE
    TIPKVFTHIHVHFKVSGHGLKEHHVKRAIKLSSEKYCSASIMLGKVASISHDYEIIDID

    >gi|77164480|ref|YP_343005.1| pyruvate/2-oxoglutarate dehydrogenase complex dihydrolipoamide dehydrogenase (E3) component and related enzyme [Nitrosococcus oceani ATCC 19707]
    MTPVSAENNFDVLVVGGGTAGTNAARAACNAGASRVGVVYIPEMFNTCVQEGCMPSKSVLASSAQGYSFLEAIYRKDVHL
    NRLARALKGKMQRAPYTLIEGEARFLPGKEGVEVTQGKKTRRLWAKNYVIATGSHAWIPPIKGLEGLPAGRMLVSDDIVG
    IQTLLGEAPKRLLVLGGGPIGLELATFFARLGTEVLILDTAGLLGHFDSEFGEARLRALKTTPHMNSLVPGELQSVADTA
    NGLLCHIVHQGNLLERYADKLLIATGRRPNIEALALENAEVQVEGSTIQHNEYLQTSNPHIYIAGDAINHHQILHYAAEM
    GQVAGANAAYGKPTAVMDYQKFSLAITFDEYPSALIGLTEREAKAQGYDVISATQDLSSLGMGILEDLPWGLWKLVADRR
    DGRVLGSQIFGPSSAPEIIQLLSPILYYQGTLRDIVRMTWYHPTYAELLRSLARRLCSENGIECPGA

    >gi|77164485|ref|YP_343010.1| electron transport complex, RnfABCDGE type, A subunit [Nitrosococcus oceani ATCC 19707]
    MSEYALILVSTVLVNNFVLVKFLGLCPFMGVSRKLETAIGMGLATTFVLTLSSVCSYLINEYLLTPLGIEYLRTIAFILA
    IAFVVQFTEMVVHKTSPLLYQVLGIFLPLITTN
    CAVLGVALLNIQHQHGFLSSALYGFGAAVGFSLVLILFAALRERIAA
    AEVPQPFQGPAIGLITAGLMSMAFMGFAGLVKG

    >gi|77164499|ref|YP_343024.1| protein-methionine-S-oxide reductase [Nitrosococcus oceani ATCC 19707]
    MKRIPALSLILALLIANTVFAENGEKKTFNENTFNKPSLEEIKTILTPQQYQVTQEEKTESPFNNAYWNNNKAGIYVDII
    SGEPLFSSTDKYTSGTGWPSFTNPINKKYIVTKEDWSFFMKRIEVRSKYADSHLGHIFNDGPPPTGLRY
    CINSAALRFIP
    VEKLREEGYEKYLTLFEKNVK

    >gi|77164503|ref|YP_343028.1| hypothetical protein Noc_0989 [Nitrosococcus oceani ATCC 19707]
    MARTESMMLDLGTQAPDFQLLEPATGRTVSLADFKGAGGLLVIFMCNHCPYVKHISSALSQFAREYQPKGLAIVGISVND
    VENYPDDSPEKMAEEVEAQGYIFPYLYDETQEIAKAYKAACTPDFFLFDKNHKLVYRGQFDDSRPGNDLPVTGEDLQTAV
    KAVLSGQPIPNEQRPSMGCNIKWKPGNEPDYFG

    >gi|77164557|ref|YP_343082.1| HesB/YadR/YfhF [Nitrosococcus oceani ATCC 19707]
    MNVTNAMPNPLIFTDIAAGKVKELIEEEGNDKLMLRVFITGGGCSGFQYGFTFDETSHEGDTRVKNGGVTLLIDPTSYQY
    LVGAEIDYTEGLEGAQFVIRNPNAETTCGCGSSFSP

    >gi|77164567|ref|YP_343092.1| thioredoxin [Nitrosococcus oceani ATCC 19707]
    MNKIIRWPLILTVALLAGIGGYILYQTQQDDRPTTGPIRPVFKLPDAHGTEHDIREWDGKVVVINFWATWCPPCLEEIPE
    FIELQRSLGEQGLQFIGVAIDRPDKVKAFIKEYGINYPILVSEEKAPRVAMDYGNELDVVPYTAFINRAGQIVYTHAGVL
    DKETTKSFILPLL

    >gi|77164568|ref|YP_343093.1| cytochrome c biogenesis protein, transmembrane region [Nitrosococcus oceani ATCC 19707]
    MRIFLALALMLLGNTSATAGLLDRLGLGEAEKPPLLKVDQAFIYNAAVEDGNTIIARVNIVEGYYLYRDKFAFQILDTPE
    VKVSTAKLPPGKVKEDPFFGTTEVYEGKTELQIPIKLNRQGTTPETVILEASLQGCSEIHGICYPPATQRISLELPSPSI
    DEAGSIEADSGLTPEQSPAIALSTQDRIVQTLFNDQIWLTLAAFFGFGLLLSFTPCVFPMIPILSGIIVGQGKNITTWRS
    FMLSLAYVLAMALTYTVAGIVASLLGENLQATFQHPGILIGASLIFVLLALSMFDLYHIQLPSRLQTRLLRLSQKQKGGT
    LLGAGLMGLFSALIVGPCVAPPLAGALIYIGESGDALLGGSALFALSMGMGTPLLFLGASAGKLLPHVGSWMQPIKYLFG
    VLLLAVAIWLLSRILPQAIIMLLWGALFIIGAVYLGALEALGPDTTGWSRLWKGMGLISLVYGTLLIIGAASGGGTEWQP
    LRGLTVARSANTPTSTESLNFQPVKGIQGLQLALQGAGERLVMLDFYADW
    CVDCKRMEATTFSDPTVKNALRNTLLLQTD
    VTAYDDQDKALLNQLSLYGPPSILFFGPDGRELRQVRLIGQASPEEFLRHLQQVNTLLAQQTSKGA

    >gi|77164602|ref|YP_343127.1| SelT/selW/selH selenoprotein [Nitrosococcus oceani ATCC 19707]
    MSNKIEIQYCTKCRWLLRAAWIAQELLTTFEQEISELTLRPGTGGVFNIFANGKLVWSRKEAGRFPEITELKQLVRNQIA
    PTKDLGHADKKHK

    >gi|77164678|ref|YP_343203.1| SoxR-reducing system protein RsxE [Nitrosococcus oceani ATCC 19707]
    MAPPPVSYSQISRAGLWNNNVALVQLLGLCPLLAVTGTVINGLGLGLATLLTLVASNSLVALIRHWVPKEVRLPVFVLII
    ASIVTTIELLMNAYFYDLYKVLGIFIPLIVTN
    CAIIGRAEAFASRQKVGRAFTDGLMMGLGFTLVLMLLGGLREALGQGT
    LLDQAHLMFGEAARDLKLTLVEDYRGFLLAILPPGAFIGLGLLIALKNMIDRRLAQRTAVQKSYATKPIDVLPERI

    >gi|77164729|ref|YP_343254.1| hypothetical protein Noc_1223 [Nitrosococcus oceani ATCC 19707]
    MNKPRLVLFYLLLVAIPAVPTAMAAEIGQQAPNCLLKPFEKEDQVFLQQWQGKVVYVDFWASWCPPCLKSFPFLNDLHQR
    FSDQGLHIVGINVDEKLSDAQDFLARVPAHFDVVVDPDQQCARSFDIQAMPSSFLIDQKGVIRHTHLGFRSGDTQELEAW
    TQKLLQEKTANP

    >gi|77164762|ref|YP_343287.1| dihydrolipoamide dehydrogenase [Nitrosococcus oceani ATCC 19707]
    MANEAESTQLAIIGGGPGGYAAAFLAADLGLEVTLIDGEPNPGGVCLYRGCIPSKALLHVAKVISESKEAGAWGIHFSEP
    EIELDKLRSWKEQVVRKLTGGLGQLSRQRKINYIQGQAGFKDARTLEIKKQEGKAQLRFQNAILATGSYPASLPHLSPDS
    PRLLDSTSALEIQDIPKTLLVIGAGYIGLEMATVYASLGSQVTVVEMTEGLLPGADRDLASVLGKRLEGVLHSLLFKTKV
    THMEEEAKGIRVHLEGAEEGKHLFEKVLVAVGRKPNSAIPGLERTQVELNDKGFIQVNAQRQTTDSAIFAIGDVVGEPML
    AHKASHEGRIAAEVVAGRRVFFEPRTIPAVVFTDPEVAWCGLTETEAKAEGQAIQVARFPWAASGRAVTLDRTDGLTKLI
    IDPETERILGAGIVGPGAGELIAELVLAVEMAAVASDIKLSIHPHPTLSETVMEAAEVFFGQSTHLYRPAKK

    >gi|77164811|ref|YP_343336.1| peroxidase [Nitrosococcus oceani ATCC 19707]
    MALHIGDVAPDFTQESTIGPLHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALSVDDVDSHKGW
    ISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRDFGEILRVIDSLQLT
    DNYSVATPVDWKDGDDCVIVPSLTDPEVLKEKFPKGYEEIKPYLRMTPQPNK

    >gi|77164827|ref|YP_343352.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant [Nitrosococcus oceani ATCC 19707]
    MHRIEYVPDATFKTRVRDESLEGSNPYRWQDITSKEIFAGKKVIVFSLPGAFTPTCSSNHLPRYEELYDEFKAMGIDEIY
    CISVNDAFVMFQWSRHMEAKKVKMLPDGNGEFTRKMGMLVDKSNLGFGMRAWRYSMLVDDGKIEELFVEPDFSDNCPTDP
    FQVSDADTMLAALKGEEPTEVSEPRRAFVG

    >gi|77164875|ref|YP_343400.1| hypothetical protein Noc_1376 [Nitrosococcus oceani ATCC 19707]
    MRASGTLAPEWKVAQWFNTQQPLQLADLRGKVVVMHAFQMLCPGCVVHGLPQTQKIYNVFDANEVVVVGLHTVFEHHEVM
    TPQALEVFIHEYRYTFPIGVDQPDGQSGLPLTMRAYGMRGTPSLILIDHKGRLRKHSFGRDDDIQVGADIATLVSEAKAA
    PLAEAENASGGDGCDEDKCTA

    >gi|77165088|ref|YP_343613.1| glutathione reductase [Nitrosococcus oceani ATCC 19707]
    MTSYDFDLFVIGAGSGGVRSARMAAGFGARVAIAEERYLGGTCVNVGCIPKKLFLYAAHFSEDFEDATGFGWTVGQRQFD
    WSTLIQNKNTEIQRLNKIYENLLGKAGVTLVSGRARLETPHTVSVNNHCYTAERILVATGGWPVVPEFPGREHVITSNEA
    FFLDKLPERVAIVGGGYIAVEFASIFNGLGSNTTLLYRGPLFLRGFDDDLRQNLAQEMSKRGVKLCFNTQVAAVEKGGQG
    FTIKCHDGKTLEVDALMYATGRAPNTLGLGLEDLGVELSWNGAVVVNDHYQSSIPSIYGIGDVTHRLNLTPVALAEAMVL
    TRILYGGGYSRLDYSNIPACIFSHPNVATVGLTEEQAGEHCGEINVYRSSFRPLKHTLSGRDERTMVKLIVEKTTDRVVG
    AHMLGPDAGEIIQGIAIAIKAGATKSTFDSTLGIHPTAAEEFVTLRQPVTGL

    >gi|77165127|ref|YP_343652.1| HesB/YadR/YfhF [Nitrosococcus oceani ATCC 19707]
    MAITVTASALKQIKKVLSQQENVEGLRIGVKKSGCSGYAYVLDFAKQVKSEDTIFDHDGVKILVDKKSLNFIDGTELDYR
    REGLNESFKFQNPNVAGTCGCGESFSI

    >gi|77165253|ref|YP_343778.1| protein-methionine-S-oxide reductase [Nitrosococcus oceani ATCC 19707]
    MTEKIKTREQFLTHGLMVLCLVVLIGLRPALALEAGKAPAKATFAGGCFWCMEPPFDNLEGVISTTSGYIGGHMKNPTYE
    TVSGGKTGHAEAVQISYDPNQISYAELLAIFWRNIDPLAENRQFCDHGSQYRSAIFYHNETQQRLAEESKAQLAQSGRFN
    QPIVTEIKLATQFYPAEAYHQNYYQKNPIRYKLYRFGCGRDQRLQELWGDAS

    >gi|77165474|ref|YP_343999.1| metallo-beta-lactamase family protein [Nitrosococcus oceani ATCC 19707]
    MIFRQLFDPESSTYTYLIGDPATKEAVFIDPVNTRVDEYLNLLNKYNLKLKYSLETHAHADHITASGLLRQHTGAKTGIG
    QACGAQYADYQLKDGVVLAFGQGEEIKVLATPGHTPGSISYLWRDRVFTGDALLINGCGRTDFQGGDPGTLYDSVTQKLF
    TLPGETIVYPGHDYNGRWVSSVEQERTGNGRLAGKTRAEFIEIMNNLNLPKPRLIDEAVPANRRCGLTEEEIRQDTMMGE
    KRVSTPQDLVQEARKQVREIDVATVKQRLGDGKTAIIDVREPEEFAAGHLPGAINVPRGVLEFRLGNTAELADPNIPIIL
    Y
    CQTGGRAALAAWSLKCLGYTDATLIAGGYDAWRAAKQNAD

    >gi|77165545|ref|YP_344070.1| methionine sulfoxide reductase A [Nitrosococcus oceani ATCC 19707]
    MFKIHPKIEIPAAEEALPGRAEKMPVPQQHYVNGHPLTPPFPEGMEQALFGMGCFWGAERKFWQTEGVYTSAVGYAGGHT
    PNPTYEQVCTGMTGHTEAVRVVYDPKIISYPSLLKIFWESHDPTQGMRQGNDVGTQYRSAIYTYNNAQKTAAEASRKNYE
    KNLQEAGYAPITTEIGPAPEFYYAESYHQQYLAKNPGGYCGLGGTGVVCPTQIERNLSE

    >gi|77165569|ref|YP_344094.1| methylated-DNA-(protein)-cysteine S-methyltransferase [Nitrosococcus oceani ATCC 19707]
    MNASTKNMQLSTAIANDPRWASAVARDPKVDGKFYCNVEIRFAIGKCSLGATLVAQSNRGICAIFLDDDPEKLVHDLEDQ
    FPRANLVGGGAQFEQLIAEVVSFIEAPSIGLNLPLDIRGTAFQQRVWRALRGIPAGSTASYSAIARHIGAPKSARAVARA
    CAVNTLAVAIP
    CHRVVRSNGNLSGYRWGLERKRALLKKEAKDLEFIHKCQA

    >gi|77165574|ref|YP_344099.1| pyruvate/2-oxoglutarate dehydrogenase complex dihydrolipoamide dehydrogenase (E3) component and related enzyme [Nitrosococcus oceani ATCC 19707]
    MTESYVIKMPQLSDTMTEGVLVSWEKEIGEFIERGTVVATVETDKAIMDVEVFREGYLSGPQLPVDGVVAVGEPIAYLVA
    EAEQVVSTEADSSPKPAPEVDEPPKFEPAGASKPKTRIPAMPEGATPAPHPSHTRATPYARQLAGAHGIDLAGVKGSGSA
    DVIVAADVVSGEGAKGMTRRIFKLPGAGRPMDSMEKAIAHNMEYSLSMPLFRATVHVDPSRLVAAAKKQGSSVTVALAKA
    TALAIEEHPKINSVYQHEDRILEREQIDVGLAVATEGMGLVVPVLRDTSHRDIADLSAAWIDLVERARIKRLKPEEYSNP
    TFVISNMGMLGVAYFDAIPSPGTSAILAIATTGPQGMPVTITADHRIVNGADAARFLNTFKERVEHPETWISGSGGDGTV
    PTPKKSPKAPLPLEGDWDYDVVVIGAGPGGEDCARELVEHGLKVALINDSPLPGGE
    CLWRGCIPSKTWRAAADRIRDRVH
    DARLGVEGTAPTALSWKTLEATRRQLLQSRGEMALKADKGMKIKFIQGHARFADEHHVEVVTAGNSDDPFSRTQPGSNSP
    SQKISFAGAVIATGAPPFIPPIPGAQEGLREGGVLTSDTVWGLEQIPKRLAVIGGGAIGVEMAQIFQDFGSEVLLLEAQD
    RLLAEVEPEVGKLLAGVLNADPRLTVQTSTKVQAISGQPGAMEVSFDDGEGASHRLEVDHVIMATGKRPHLEPLALDQAG
    VATENGAIRVDAQCTTSKPHIFAVGDVIGGLMLAHTAAQQGRVAAATILGEAHAYELEKDCGVIFTRPQAAFVGLSLVQA
    KERGIDAAEVKMPIRIDAKAMISNETEGLIKIVADKDSHRIIGVHFLADHADTLIGEAVMMVAGNMTLEQVARAIHPHPT
    QTEMFGEMARRLLSRLRRTQRR

    >gi|77165716|ref|YP_344241.1| thiol-disulfide interchange protein DsbC [Nitrosococcus oceani ATCC 19707]
    MGKKLLGFLLAGGLVTLSFSVVGDEEIKAVRASLQKLVPGVEPQSIKPAPIPGIYEVVLEGQVFYLSQDGRYMVQGQLVD
    LATRTNLTEERLKVIRAAAISDLDEQNMIVFGPKQAKHTVNVFTDID
    CGYCRQLHQHIEEYNALGLKIRYLAFPRAGIGS
    SSYDKAVEVWCAKDPHQAMTQAKAGKSVEDTAKCENPVADQFKLGQSLGVNATPTLMLEDGTVLPGLVRPQALVNLLEQK
    VAAHP

    >gi|77165719|ref|YP_344244.1| methylated-DNA-(protein)-cysteine S-methyltransferase [Nitrosococcus oceani ATCC 19707]
    MVHSVYGAIVATPLGKLGLSTSGNILIGLDFLPPNIPEYFPSDSTARVALAQLQAYFADPRVMFTLSLLPQGTAFQKRVW
    HTLRLIPPGSTVTYGKLAKKLKTSPRAIGAACRSNPLPIFIP
    CHRVISSQGLGGYSGATEGPYLDIKAWLLRHETEGG

    >gi|77165888|ref|YP_344413.1| glutaredoxin-like protein [Nitrosococcus oceani ATCC 19707]
    MDTMEQIKQAVESNSIILFMKGSPQFPQCGFSGRTVQALQACGTEFAYVDVLANPEVRALLPQYSNWPTFPQLYINGELV
    GGCDIILELFESGELQTKVQEVVPHTSEEG

    >gi|77165984|ref|YP_344509.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant [Nitrosococcus oceani ATCC 19707]
    MTEVTIGKTVPDFELPATSGQTVKLSQLQGQNVVLYFYPKDDTPGCTREGQDFRDLHPEFKRLNTVIFGISRDTLKSHET
    FKAQQRFPFELLSDKDATVCRLFEVIKPKKMFGKDVKGIERSTFLIDQEGILREEWRKVKVEDHAAEVLAATKAL

    >gi|77166007|ref|YP_344532.1| hypothetical protein Noc_2549 [Nitrosococcus oceani ATCC 19707]
    MPNPSVKNHLQGQTSPYLLQHVDNPVDWYPWDEEALARAQEEDKPILLSIGYSACHWCHVMAHESFEDSETAAVMNQYFI
    NIKVDREERPDLDQIYQLAQQMLTGRPGGWPLTMFLEPIKQAPFFGGTYFPPEERHGLPGFKDLLQRVAEYFHTRREAIQ
    SQNERLLDAFGDLDARLPAAEVEGLNRAPLQAAHRQLAQAFDSRHGGFRGAPKFPNPSSIERCLRDARGEHLTEDEKQQA
    LTMARLTLEQMAQGGIYDQLGGGFCRYSVDEEWRIPHFEKMLYDNGQLLVLYRDAYRLWGSGLFRRILEETGHWAVREMQ
    SPEGGYYSSLDADSEGHEGKFYVWTREQVRALLGEEEYALAARYFGLDQPANFEGYWHLYAATVPEALAQEMKVPAPGLQ
    EQLTAAKQKLFAAREARIRPGRDDKILTAWNGLMIKGMAAAGQALAQPVFIASAERAVDFVRAHLWQKGRLLVSYKDGRA
    QHRGYLDDYAFLLDALLELLQVRWRDGDLSFAVDLAEAVLERFEDKAQGGFYFTADDHEILIHRPVPLMDDATPAGNGVL
    AWSLLRLGHLLGEVRYLKAAESTLKAAWKSIQQTPHAHCSLLKTLEEWLIPPQIVILRGGGEELETWRAVAAAEYAPRRV
    ALAIPLEAQDLPGILGEYRPQGTAVTAYVCSGHTCSAPLTRREALKEHLATQGR

    >gi|77166041|ref|YP_344566.1| thioredoxin [Nitrosococcus oceani ATCC 19707]
    MTDRIIPVTVTDATFEEEVLKSEQPALVDYWAEWCGPCKTVAPILEEIANDYQGKLKICKLNIDENPSTPPRYGIRGIPT
    LMLFKNGNVEATKVGALSKSQLSAFIDSNL

    >gi|77166057|ref|YP_344582.1| disulphide bond formation protein DsbB [Nitrosococcus oceani ATCC 19707]
    MRLSVRWVFFLGFFLCALMLAIAGYFQFVENLEPCPLCILSRVAVLAIGGVFLVAALHNPKSWGIKVYALLGFVVTLIGI
    GITGRHVWLQSLPADQVPA
    CGPGLNFMLDNFPLTETLELVFRGSGECAEVQWSFLGLTIPGWTLVAFLFLGVISLWQMGR
    TGGGAGKLT

    >gi|77166186|ref|YP_344711.1| protein-methionine-S-oxide reductase [Nitrosococcus oceani ATCC 19707]
    MENKVRKTEAEWKAQLTPAQYHVTREAGTEPAFSGKYYHHQEGGTYCCVCCGNPLFSSEQKYESGSGWPSFWNPIDSQSL
    EKRSDDSHGMSRIEVRCARCDAHLGHVFGDGPAPTGQRY
    CINSNALDFETDSPSI

    >gi|77166212|ref|YP_344737.1| putative mercuric reductase [Nitrosococcus oceani ATCC 19707]
    MSHENNLHIAVIGSGGAAMAAALKGAERGARVTLVERGTLGGTCVNTGCVPSKILIRAAHIAHLRKESPFDGGISVQRPV
    IDRAALLAQQQGRVEELRDAKYERILRGHPAVTVLHGEARFMDAHQLAVTLTEGGEQTLRFDRAFIGTGARPAEPPVPGL
    ADTPYLTSTRALTLESVPERLLVIGAGFVALELAQAFARLGSQVTVLARSRMLSREDPAVGEALEAAFCREGIQVLKETQ
    ASRVDYRDREFVLETNAGTWRAEQLLVATGRTPNTEALDLESIGVETARGAILVDEHLQTTVPGIYAAGDCTDQPEFVYV
    AAAGGSRAAVNMTGGEATLDLSAMPGVLFTDPQVGTVGLTEAQALEQGFNVESRVLDLENVPRALVNFDTAGFIKMVAER
    DSGRLLGVQAVAGEAGELIQTAVMALRTRMTVQEIGDEPFPYLTMVEGLKLCAQAFTKDVTQLSCCAG

    >gi|77163858|ref|YP_342383.1| signal peptide protein [Nitrosococcus oceani ATCC 19707]
    MTYLFHGVLKRAIWLLVLGIGAVAVAGIGTAPLPFESGSLEKILDSRAGKPFLLVMWSLECPPCRKEMDLLAEMRRQHPK
    LDVVLVSTDEMERADQVTAAVKGHGLEKTESWLFAGPAQRLRYEIDPGWYGEMPRSYFYDANHKRAAVSGALEEAQIQAW
    LEHVYP

    >gi|77164060|ref|YP_342585.1| hypothetical protein Noc_0535 [Nitrosococcus oceani ATCC 19707]
    MRLIYQLSLGLLLVLPVISSHAEESVWDKAQVSYFGPSNITVYRSPTCGCCKKWVEHLEQHHFTVKDITTDNMQTLKQQY
    GVPRELASCHTAIIDGYVIEGHVPADDIKRLLMEKSKITGLTVPAMPVGTPGMEMGARKDPFHVLQFNEAGQSKPFNAYQ
    NY