Nitrosococcus halophilus Nc4 uid46803

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|292490194|ref|YP_003525633.1| glutaredoxin 3 [Nitrosococcus halophilus Nc4]
    MPKVVMYTTAWCPYCIGARRLLDDKGIGYKEIRVDLEPEQRAIMIDRSRRRTVPQIFIDDQSIGGFDDLVRLDRARELDT
    LLGLA

    >gi|292490269|ref|YP_003525708.1| dihydrolipoamide dehydrogenase [Nitrosococcus halophilus Nc4]
    MSERYDVVIIGAGPAGYVAAIRCAQLGLRTACIDKWLSPEGKPSLGGTCLNAGCVSSKALLDSSELYQRAQTEFAEHGIK
    AAQVSVDLAAMQARKTRLVHRLTANIATLFEDYQIQWLPGHGRLLENNQVEFTPHEADGPQMLAAKNVILASGSRPMELE
    AAPIDGERIVDSTGALSFQEVPRRLGIIGAGVIGVELGSIWSRLGAKVTLLEARDGFLPMVDKAISQEAHKRFKQQGLDV
    RLGARVVSTRVTSKQVTVHYQIGEEDHELKVDKLIVAVGRQPYSEHLFALETGLLLDERGFIHVDEYGATNLPGVYAIGD
    VVRGPMLAHKGSQEGIAVAEAIAQGKETTVKRDNIPWVIYTEPEISWAGRTEEALRDAGIEVRVGTFPFAASARANAMDG
    TEGLVKVVADANTDQLLGVHIIGPWASELIAEAVLAMEFAASSEDLARTIHAYPSLAEALHEAALDVDNRAIHVAGR

    >gi|292490327|ref|YP_003525766.1| Heavy metal transport/detoxification protein [Nitrosococcus halophilus Nc4]
    MEKTYKVEGMTCGGCAQSVEKAIKGIAPAATVKVDLENKQVTVTGVEDDTLVAQAVEGAGFDYEGLVSP

    >gi|292490328|ref|YP_003525767.1| heavy metal translocating P-type ATPase [Nitrosococcus halophilus Nc4]
    MLEISNLDSVQQSPPREILTGAVQTLALPIKGMTCATCSTRLERVLNKVPGVVKSQVNLASEQANIAFDPQQASPEQFYQ
    AITQAGFTVPTAGMEFRIGGMT
    CAACSARLEKVFSRLPGVSKATVNLATERAVVTAPSGVLSPATIIAAAQRAGFTAEPL
    SSLAERRAQEEAESTARERHEGRQLLLAALLTLPLALPMLLMPFGIHLGLPAETQLLLATPVQFWIGKRFYVGAYKSLRG
    GAGNMDVLVALGTSAAWGLSTWNTLLPGTGHHLYFEASAMVVTLVLLGKWLEGRAKRSAASAIHALMALRPATARIEREG
    KVVEVPAEQVAEGDIVLVRPGERMPIDGLILDGRSQLDESLITGESLPVSRGEGETVTGGSVNGEGLLRIRATTVGAEST
    LARIIRLVEDAQASKAPVQKLVDQVANIFVPVVVTLAFLTFAGWWLLDGAADTAFKAAVSVLVIACPCALGLATPTALMV
    GTGAAARHGILIRDAVALERARDSDTVVFDKTGTLTEGQPAVAEILPIKISGKELLRLVASAQQGSEHPLAKAVLTKAQD
    LPLSPPQNFRSLPGRGLCTQVEERNLLVGNLRLMRENQVDLTPLTAQAQALEESGHTLMWVAEMDSAPQLLGVLAVTDPI
    KSVTPQAVAALGAQGLTTVMLTGDNPRAAKSVADKVGIDHVIAEVLPEDKATQIQALRAEGRHVAMIGDGVNDAPALAAA
    DVGMAMGTGTDVAMEAAGITLMRGDPTLVAEALSISRATYRKIRQNLFWAFIYNVVAIPLAASGLLNPVVAGAAMAMSSV
    SVVSNSLLLRRWRPGTQLK

    >gi|292490405|ref|YP_003525844.1| UBA/THIF-type NAD/FAD binding protein [Nitrosococcus halophilus Nc4]
    MNDQQLLRYSRQILLPQIDIEGQRKLLNARVLVIGVGGLGSPVALYLAGAGVGQLTLVDPDQVELSNLQRQILHDSEAIG
    LPKVESARRRLQDLNPEVEVRAVADRLEGEDLEAAVAQADVVVDGSDNFATRFAVNIACVRAGRPLVSGAAIRMEGQVAV
    FDSRRPEGACYHCLFREGEENEET
    CSQTGVIAPLLGIIGSVQAMETLKLLLGIGQSLQDRLLLFDALGMHWREIRIRRDP
    QCPICNDFQDRSQELAK

    >gi|292490777|ref|YP_003526216.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nitrosococcus halophilus Nc4]
    MSEITIGKTVPDFELSATSGQTVKLSQLQGRNVVLYFYPKDDTPGCTREGQDFRDFHAEFERLDTVILGLSRDTLKSHEN
    FKAKQDFPFELLSDQNETVCQLFDVIKPKKMFGKDVKGIERSTFLIDKEGVLRKEWRKVKVEGHVAEVLEAVKSL

    >gi|292490975|ref|YP_003526414.1| periplasmic protein thiol/disulfide oxidoreductase DsbE [Nitrosococcus halophilus Nc4]
    MLRYTIPLIVFIGLVLFFADGLQRDPRQVPSPFIDKPAPELGVPRLKTPDQEIYRSDLLGKPALINVWASWCVACRAEHE
    VLLRLARETQLPIIGLNYKDKREAALQWLANLGDPYTTIAVDADGQVGIEWGVYGVPESFLLDPQGVIRYKQIGPLTWKV
    VEEELIPLIQSFETQGG

    >gi|292490986|ref|YP_003526425.1| OsmC family protein [Nitrosococcus halophilus Nc4]
    MTRGLSPMKARIKWIENSSFAGQSGSGHTVVMEGPPESGGHNLGIRPMEMLLLGMGGCTAFDVVQILQKSRQPITDCVVE
    ISAERAETIPKIFTHIHVHFKVSGHGLKAHHVKRAVELSSEKYCSASIMLGKSAAIHHSYEIIDLN

    >gi|292491051|ref|YP_003526490.1| methylated-DNA/protein-cysteine methyltransferase [Nitrosococcus halophilus Nc4]
    MVRTDSGYGAIVATPLGKLGLSVSGNVLTGLDFLEPDIPEHFPSDPVTEAALIQLQAYFADPKTMFTLSLLPQGSPFQKR
    VWQALCFIPSGSTVSYGMLAKELNTSARAIGGACRANPLPIFIP
    CHRVVAKHSLGGYSGAMEGAQLDIKAWLLQHEAQGA
    RKS

    >gi|292491054|ref|YP_003526493.1| thiol-disulfide interchange protein DsbC [Nitrosococcus halophilus Nc4]
    MGRKLLGFLLTGVLVTFAFSAVGDEEKEAVRASLQKWAPGVQPQSIKAAPIPGIYEVVVEGQVFYISQDGRYAMQGQLLD
    LANRTNLTEERLKVMRAAAIDGLDEQNMIVFGPEQAKHTVNIFTDID
    CGYCRQLHRHIDEYNELGIKIRYLAFPRAGIGS
    SSYDKAVEVWCAKDRHQAMTQAKAGKPVENTAKCNNPVAEQFNLGQSLGVNATPTLILEDGSTLPGLVRPQNLVNILERK
    IAAHP

    >gi|292491233|ref|YP_003526672.1| Methyltransferase type 11 [Nitrosococcus halophilus Nc4]
    MSQQANVLERYSEGAQAHQTELCCAVEYDSRLLQILPQEIIDKDYGCGDPSPYIREGDVVLDLGSGGGKICYMAAQLVGA
    QGRVIGLDMNDDMLALAQKYQAEMAERLGGDRVEFKKGLIQDLALDLAAVDAYLAANPVSRSRDLARLEAFKTQQRKESP
    LIPDGSVDLVISNCVLNLVDDGAKAQMVAEIFRVLRPGGRVAISDVISDEAVPQHLRDDPKLWSG
    CISGAFQEKEFLDAF
    LAAGFVAVSYDKWEAEPWQVVEGIEFRSATLTAVKPEGSECMDVGQAVIYRGPYTQVSDEEGHVFPRGERIAV
    CERTFRF
    LTTGPYKDDFIGISPAVPQEPVTWCAPAGTRRPPQETKGGIHRGGSWVESGCCS

    >gi|292491398|ref|YP_003526837.1| Peroxidase [Nitrosococcus halophilus Nc4]
    MALHIGDVAPDFTQESTIGPLNFHEWIGDSWVVLYSHPADYTPVCTTELGLTAKLADEFKKRNVKVAALSVDDTESHKGW
    INDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYPPSTGRNFDEILRVIDSLQLT
    DDYSVATPVNWKDGDECVIIPSLKDPEVLKEKFPKGYKEIKPYLRMTPQPNK

    >gi|292491499|ref|YP_003526938.1| UBA/THIF-type NAD/FAD binding protein [Nitrosococcus halophilus Nc4]
    MSKITVHIPSPLRGDVGGAEQLQLQADTVGGALKALGVAHPGILNRLLTPEGEVRPFVNLFLGEDNILALQGLETPLKDG
    DVLTIIPAVAGGSGKDCRLQSLKRSIPEITPTEALALQAKGAVLIDVRESEEIAQGSPAGAYRLGRGYLELRVEQSVPDF
    NCTVLTL
    CGSGTRSLFAAESLKQLGYGDVRSIAGGFNRWKDEGLPFEVPQILDGAARSRYSRHLLMPEIGEKGQQKLMAS
    KVLLVGAGGLGSPASLYLAAAGVGTLGLVDHDVVDRSNLQRQVLHRDDRVGMPKVASARQTLAALNPTIRINEYESRLES
    RNVEEICRDYEVVIDGSDNFPTRYLVNDACVKLGLPNVYGAVYRFEGQICVFWPARSGPCYRCLYPEPPPPELAPS
    CAEA
    GVLGVLPGVIGLLQAVEALKILLKLGEPLLGRMLYYDALKASFSELKLARRSHCAYCSEGAVFPGYVNYDQTCSTANVSL
    KSS

    >gi|292491603|ref|YP_003527042.1| OsmC family protein [Nitrosococcus halophilus Nc4]
    MSEYTVDITWKRETEDFSYKNYNRAHTWHFPGGTNLSASAAPEYLGNAQLVNPEEAMIAALSSCHMLTFLAIAAYKRLTV
    DNYEDHATGIVEKNEQGKMALTHITLRPKITFSGSPAPERSTLEEMHKKAHEN
    CFIANSVLTKVAVEPVF

    >gi|292491718|ref|YP_003527157.1| hypothetical protein Nhal_1638 [Nitrosococcus halophilus Nc4]
    MFTILLMGAFAVGSTVYAATDSESYFSPEPPAWISEDADGSPQVHLYFFWSLQCPHCRQAQPFIEKLGEIYPWLIVHSLE
    LSQHPQYGQLFLEMSLPMGGRARSIPAVFICGEMIVGYDREETTGEYLRERSFQCYQRALESQLWIPANENANPHMPSLV
    IPIVGKIDPVTVSLPLLTLLIASIDAFNPCAFFVLLFLLSLLVHVRSRARMALVGGIFVFFSGLVYFLLMATWLNIFLLI
    GELQWVTLIAGLIAVLVALLNIKDFFFWGRGPSLSIPQGAKPSLFQRMGQLVRAGSSIPALLAGTVVLAVVANSYELLCT
    SGFPMVFTRILTLKELPAGTYYLFLVLYNIVYIIPLVLIVLTFTLTLGSRKLTEEQGRILKLLSGLMMLLLGLVLVIAPY
    ALDNLIIAASLIGAALLLTGIFVALKRTWLKHRRIT

    >gi|292491739|ref|YP_003527178.1| hypothetical protein Nhal_1661 [Nitrosococcus halophilus Nc4]
    MKQAVLIFLGVFLLGAGALASETTYHLKVDGISCPFCAYGIEKAFSQLEGIKIAQTDLEKGVVVVTMEEGKSLDEATARK
    VVVKTGFTLRGFKKVPKP

    >gi|292491752|ref|YP_003527191.1| mercuric reductase [Nitrosococcus halophilus Nc4]
    MTDTPGANRDLRRRPPGGAPGQARINNCCEKKEGNDIAVVGSGGAAMAGTLKAVERGARVTLIERGVMGGTCVNVGCVPS
    KIMIRAAHIAQLRRQSPFDDGIPAAPPAILRERLLAQQQGRVEELRQAKYESILDDNPAITVLHGEARFKNDRRLTVRLN
    DGGEREVTFDRCLIATGASPTIPPIPGLKDTPYWTSTEALASDRIPERLTVIGSSVVAAELAQAFARLGSRVTILARSTL
    FFREDPAIGEALTAALRAEGIEVLEHTQASQVTQGDGELLLTTRHGSLGADKLLVATGRAPNTGDLGLETAGVAVNGQGA
    IVVDAGMRTSNPHIYAAGDCTDQPQFVYVAAAAGTRAAVNMTGGEAALDLTAMPAVVFTDPQVATVGYSEAEAHHDGIET
    DSRLLTLDNVPRALVNFDTRGFIKLVIEEGSRRLIGVQAVTPEAGELIQAAALAIRTRMTVEELADQLFPYLTMVEGLKL
    AAQTFTKDVKQLSCCAG

    >gi|292491755|ref|YP_003527194.1| Mercuric transport protein MerT [Nitrosococcus halophilus Nc4]
    MSTKSLPKILGNETPAPEQTKRQNRLLVTGSLVGAVLASSCCILPLLLLTLGVSGAWISHLTVLAPYQPFFLVATFGFLG
    AGFWKVYWKPKVRCEEGSYCASPTSDRVLKTALWIATALVLTTLGINFLGPLFL

    >gi|292491788|ref|YP_003527227.1| alkylhydroperoxidase like protein, AhpD family [Nitrosococcus halophilus Nc4]
    MPVISTPPEYRFPWYIRLLFWIQKRRYGAVFEGARLWGRIPKVFVPFVLLYRAIDRRSSPIDPQLRSLVMVRVSQINHCA
    F
    CVDLNSAMVLQRGLEPDKLMALSEFKASSLFNDREKTVLAYAEAMTYQERQPTGDHFEQLRRHFDEETIIELTGLIAFQ
    NMSSKFNTALGVESQGFCVIPAQEKRIKGN

    >gi|292491831|ref|YP_003527270.1| Na+/H+ antiporter NhaA [Nitrosococcus halophilus Nc4]
    MSAERTHQLDRPVVPGRDHVLGPSDAPITLVEYGSYACPRCRAVNEQIAKIRDQFGDRLRYVFRHKPLTGNDLALRAAEL
    VEQAETPEQFWKAHIALMTRSPTLTEEDLSAIASNLGLPPRGSAAATTAADRAKAHVAADLMSAQASGALLTPTFFINGR
    RYDGPWDEVSFADALLGSLGHRVRTAALEFAAWTPALGVLLLLASLVAVALTNSPFAAGFSAFWHRSLGFTWGDTGYQLP
    LLNWVNDGLLSIFFLVVGLEIKREFTIGHLSSRRLAALPVAAAIGGMVVPASLYALAIPGGPWASGWGVPMATDTAFAVA
    LIAMMGKRVPVELRIFLTAAAIVDDIGAITVVALFYSSDLHSGFLVAALAIVGLLMLLNKSGIYRVAPYALLGLALWVCV
    HEGGIHATLAGVVLALLIPTRPPPNLSALMAQADTIIAVETSEGPEGLGHRLSTPALQALDAIHDRLESPAARVLRHVEP
    WSSYVVLPVFALANAGVALTVDVLDGHESLFAAITLGLVVGKPVGMVLVPALAVRLGLATKPAEYSWMQVIGAGALSGIG
    FTMSLFIAGQAFPLEADFAAAKIAVFSASLLSAIIGVAILGWAGTKEKEAS

    >gi|292491987|ref|YP_003527426.1| iron-sulfur cluster assembly accessory protein [Nitrosococcus halophilus Nc4]
    MAITVTDSALKQIKKVLSQQANVEGLRVGVKKSGCSGYAYVLGFAEQVEPEDTVFDHDGIKIVIDKQSLGFIDGTELDYR
    REGLNESFKFQNPNVVASCGCGESFSV

    >gi|292491991|ref|YP_003527430.1| protein of unknown function UPF0061 [Nitrosococcus halophilus Nc4]
    MPSSTAMKHQDIGWHFDNTYAQLPGHFYTKLHPVPVREPRLVIANDALAEELGLNFKAISEDALAQLFSGNQLPEGAEPL
    AQAYAGHQFGHFTYLGDGRAHLIGEHLTPDGKRVDIQFKGSGQTPYARRGDGRAALGPMLREYIISEAMHALGIPTTRSL
    AVVTTGEPVYRETVLQGAILTRVASSHLRVGTFEYLAAQEDKAGLKQLTDYAIQRHYPEIIDSDTPYFDLLKAVMACQIK
    LITEWLRVGFIHGVMNTDNMAIACQTIDYGPCAFMDSYDPGTVFSSIDYMGRYAYGNQPRIAQWNLARFAEAILPLLHEN
    IEKAAAMAEEAIQSFKALLQQEWLAMMRRKLGLFGEENEDMEFINGLLQWMQRSHADYTNTFRDLMDEHFPEDPHYQDQA
    FKHWYERWQQRLERNTKPFSSSLCLMGATNPVVIPRNHRVEAALNAMEQNADFSKLHELLDVLSEPYKDKEKYTKFKNPP
    APKERVYQTF
    CGT

    >gi|292492054|ref|YP_003527493.1| hypothetical protein Nhal_1999 [Nitrosococcus halophilus Nc4]
    MRKNNKVEIRYCTQCRWLLRAAWMAQELLTTFDQEISELTLRPVTGGVFEILANGKLIWSRKEAGRFPEITELKQLVRDQ
    IAPDKDLGHADRKGSQSH

    >gi|292492089|ref|YP_003527528.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nitrosococcus halophilus Nc4]
    MRSSGTLAPEWNIAQWFNTSQPLQLADLRGKVVVIHAFQMLCPGCVVHGLPQTQKIYNTFDANDVAVIGLHTVFEHHEVM
    TPQALEAFIHEYRYTFPIGVDQPDGQSGPPLTMRAYGMHGTPTLILIDHNGYIRKHSFGRDDDMGIGADIATLISEAKGA
    AVEPSTPEEGRAGGGGCDEEKCTA

    >gi|292492309|ref|YP_003527748.1| glutaredoxin-like protein [Nitrosococcus halophilus Nc4]
    MDVMEQIKEAVESNRIILFMKGSPELPQCGFSSRVAQALQACGAEFAYVDVLANPEVRANLPRYANWPTFPQLYINGELV
    GGCDITLELFESGELQKMVQEAAPHPSEG

    >gi|292492580|ref|YP_003528019.1| methionine-R-sulfoxide reductase [Nitrosococcus halophilus Nc4]
    MENKIHKSEQEWKAQLTPEQYHVTREAGTELAFSGKYYHHQEKGSYCCICCGSPLFSSAQKYESGTGWPSFWNPIREQAL
    EMRPDNSHGMHRVEVRCARCDAHLGHVFGDGPAPTGQRY
    CINSCALDFEADSSSI

    >gi|292492614|ref|YP_003528053.1| Redoxin domain protein [Nitrosococcus halophilus Nc4]
    MNKLRPALFYFLLVAIPLQTLAASEIKREAPNCMLNTFGTAEQVTIEQWQGKVIYVDFWASWCPPCVKSFPFLNNLHRRF
    GDQGLQILGINLDEKLSDAQKFLAKFPTRFDIVTDPDQQCARSFDVQAMPSSFLVDRNGMIRYVHLGFRSGDVEELRVQV
    QKILKEKAANP

    >gi|292492668|ref|YP_003528107.1| arsenate reductase [Nitrosococcus halophilus Nc4]
    MSQVTIYHNPRCSKSRQTLQLLREQGVEPVVIEYLKTPPTPEQLSEILQLLDKNPRDLMRQKEPEYQDNGLDAPNLSQEQ
    LIAAMYAHPILIERPIVLANGKAAIGRPPEKVLEIL

    >gi|292492673|ref|YP_003528112.1| Rhodanese domain protein [Nitrosococcus halophilus Nc4]
    MAMFPLLLQPDELEGRLDDRNLLIIDLCSEESYLSRHVPGAVHLDYAHIVTARPPVMGLLPDEHRLSRVLSHLGFTPESH
    VIAYDGEGNGRASRLLWTLEELGHERFSLLDGGLKAWLIEGHPFKEGRESRPSSHFHGHYQGNRVADKEYLLAHLLDPDV
    VILDARSPAEYHGEYIRAQRGGHIPGAVNFEWTRAIAQERNLRFKPINELRSSLEALGVTPDKEVICH
    CQTHHRSAHTCM
    VLKYLGYPRVKGYPGSWSEWGNDPDTPIEV

    >gi|292492719|ref|YP_003528158.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nitrosococcus halophilus Nc4]
    MSVLVTQVAPDFTAPTVMPDGTIQENFRLSDLRGKYVVLFFYPLDFTFVCPSEILAHNNRLKEFKEHNVEIVGVSIDSQY
    SHYAWRNTPVANGGIGAIGFPLVADLNHDITRAYGVEHPDGVALRASFLIDKNGVVQHQVVNNLPLGRAVEEMLRMVDAL
    QFTEEHGEVCPAGWRKGEEAIRPDAEGVAQYLAKHATTL

    >gi|292492724|ref|YP_003528163.1| Methyltransferase type 11 [Nitrosococcus halophilus Nc4]
    MSDVIQTHYQRLAERYDNFLYYSPDFVRQLTSKMIEKLALNQDDVLVDLGCGTGIYSLDILEQVPLKNPVIGVDPFPEML
    AQIPEEAPIERVAEDALDFSARPGTYNKILIKETIHHIDDRKALFKNFYQRLAPEGILLLVHVPPNVEYPLFSKALER
    CL
    NWHANPDELVSLLEDETFQVERDTLVYRHSLPKEKYFEMVASCYMSVLSSFEEEELKAGLQEMESTYADREILEFNDRFD
    FITAKKV

    >gi|292492760|ref|YP_003528199.1| electron transport complex, RnfABCDGE type, E subunit [Nitrosococcus halophilus Nc4]
    MAAPVSYGQISQEGLWNNNVALVQLLGLCPLLAVTGTVINGLGLGLATLLTLVASNSLVALIRHWVPTEVRLPVFVLIIA
    SIVTTIELLMNAYFYDLYKVLGIFIPLIVTN
    CAIIGRAEAFASRQKVGRAFADGLMMGLGFTLVLVLLGGLREALGQGTL
    LDQAHLMFGEAARDLKLTLMEDYRGFLMAVLPPGAFIGLGLLIALKNAIDHRLAQRAATRKSRAAQPAGILPERI

    >gi|292492764|ref|YP_003528203.1| electron transport complex, RnfABCDGE type, B subunit [Nitrosococcus halophilus Nc4]
    MLVAILALSALAALFGLLLGYANLRFKVDGDPVVDQIDALLPQTQCGQCSYPGCRPYAQAIAAEEADINRCPPGGEATII
    ALADLLGRDPKPLDSEQEEKPKALAVIDENRCIGCTLCIQACPVDAILGAAKQLHTVIAAECTGCELCVAPCPVDCIEMV
    PLTPDLGSWKWPFPEVIEPPLPIALQQQKAKANKPLLPEVSDFQGEEAS

    >gi|292492765|ref|YP_003528204.1| electron transport complex, RnfABCDGE type, A subunit [Nitrosococcus halophilus Nc4]
    MTEYALILVSTVLVNNFVLVKFLGLCPFMGVSRKLETAIGMGLATTFVLTLSSVCSYLLNQYLLAPLGIEYLRTIAFILT
    IAFVVQFTEMVVHKTSPLLYQVLGIFLPLITTN
    CAVLGVALLNIQHQQGFLPSALYGFGAALGFSLVLVLFAALRERIAA
    AEVPRPFQGPAIGLITAGLMSMAFMGFSGLVKG

    >gi|292492768|ref|YP_003528207.1| DsrE family protein [Nitrosococcus halophilus Nc4]
    MATFIISGSRGTDDPTMATLPFMAAKVAKEEGHEVILWLWNEAVTLARKGTADHITGVNLTPLKELLVTIQSLDVPIWVC
    GACAVARQIAEEDLVKGATIKGMPDYIKAVAERDRSVVF

    >gi|292492797|ref|YP_003528236.1| catalytic domain of components of various dehydrogenase complexes [Nitrosococcus halophilus Nc4]
    MAEPYVIKMPQLSDTMTEGVLVSWEKEIGEFIERGTVVATVETDKAIMDVEVFREGYLSGPQLPVDGVAAVGEPIAYLVA
    EAEQVEKTEASASPQPAPEAEERPKFEPAGTSKPKTKIPAMPGGATPAPHPSHTRATPYARQLAGAHAIDLAGMKGSGPD
    GVIVAADVVSGQGARGMTRRIFEVPGTGRPMDSMEKAIAHNMEYSLSMPLFRATVYVDPSRLVAAAKEQGSSVTVALAKA
    AALAVEEHPKINSVYQHEDRILEREQVDVGLAVATEGMGLVVPVLRDTSNRNLAELSASWADLVERARIKRLKPEEYSNP
    TFVISNMGMLGVAYFDAIPSPGTSAILAIATTGSQGMPVTITADHRIVNGADAARFLNTFKERVESPETWISGGSASPST
    AKEALPLEGDWDYDVVVIGGGPGGEDCARELAEHGIKVALINDSPFPGGE
    CLWRGCIPSKTWRAAADRIRDRAHDSHLGV
    GGTTPAALNWKALEATRRHVLQSRGEMALKTDKGMKIKFIQGHARFADEHHLVVDTSGNSEDPFARTQPTQPDSQGQRIS
    FAGAVIATGAPPFIPPIPGAQEGVQAGGVLTSDTVWGLERVPERLAVIGGGAIGVEMAQIFQDFGTEVLLLEAQERLLAE
    VEPEVGKLLAEILNADPRLTVQSSAKVQAISGQPGAMQVAFDDSEGTSHRLEVDYVLMATGKRPNLEPLALDQAGVAIAN
    GVIQVDAQCTTSKSHIFAVGDVIGGLMLAHTAGQQGRVAAATILGEPHAYELEKDCGVIFTRPQAAFVGLSVAQAKERGV
    DAAEVKMPIRIDAKAMINNETEGLIKIVADKASHRIIGVHFLADHADTLIGEAVMMVTGKMTLEQVARAIHPHPTQTELF
    GEMARRLLSRLRRTQRR

    >gi|292492913|ref|YP_003528352.1| dihydrolipoamide dehydrogenase [Nitrosococcus halophilus Nc4]
    MANEVGSTQLAIIGGGPGGYAAAFLAADLGLEVTLIDAEPNPGGVCLYRGCIPSKALLHVAEVISESREASAWGVKFSDP
    EIDLDKLRAWKEQVVSKLTGGLGQLSRQRKINYIQGQAGFMDARTLRIKKQEGEARLRFQNAILATGSYPASLPHLSLDS
    SRLLDSTSALEIQDIPKSLLVIGAGYIGLEMATVYGSLGSQVTVVEMTEGLLPGADRDLASVLAKRMEGVLHGLLLKTKV
    AHMEEAAEGIRVRFEGVEEGEQTFEKVLVAVGRKPNSAIPGLEHTQVELNEKGFIQVDSQRRTGDPAIFAIGDVVGEPML
    AHKASHEGRVAAEVIAGRRVLFEPQAIPAVVFTDPEVAWCGLTETEAKREGRSIQVARFPWAASGRAVTLHRTDGLTKLI
    IDPETERVLGAGIVGPGAGELIAELVLAVEMAAVASDIKLSIHPHPTLSETVMEAAEVFFGQSTHLYRPAKK

    >gi|292492916|ref|YP_003528355.1| hypothetical protein Nhal_2906 [Nitrosococcus halophilus Nc4]
    MLLSSMAEIIRGIGLMMGLAVSFFIVPATAALLDTISPPEGVGSSIYVYKDVKRKMVLIVGSSGTCASSPEYQELGDLSD
    QGAVPLLTQIAAEQFGAGGEKLFKSHCQMNYDVQVITFEDTQSSSFPPDPIDRSFNAPGGPSPEGHRNERLRNL

    >gi|292492920|ref|YP_003528359.1| beta-lactamase domain protein [Nitrosococcus halophilus Nc4]
    MYFKQFYLGCLAHASYLIGDEQTKTAIIVDPQRDIDQYLQESQEQGFTIRHVFLTHFHADFIAGHIELRDQTGAKIYLGA
    RADADYEFTPVKDGEILDFGKVRIKIFETPGHTPEGISLVVYDLEKDPAIPYGVLTGDTLFIGDVGRPDLLASFGVTAEE
    LAADLYDSLHNKLLQLPDKTLVYPAHGAGSMCGRNLSTDTVSTLGVQRQYNYALQPMSQEDFIKLVTSNQPEAPQYFSYD
    AILNRKERPTLEEALETEIQPLSLEEVLKQKDTGAQLLDVRDAADFAGSHLADSLNIGLGGSFATWAGTLLDRTQPIIII
    AEPGREREAAMRLGRIGFDSVAGYLKGGMQALDKHPDLVRRTERITAPTLSEKLSAATPPLVLDVRTEKEWKESRIGESL
    NIPLNKLEEQIDKIPQDKEIVVH
    CGSGYRSSIAASLMQKHGIANLLDLVGGFGAWKKCCPDKITT

    >gi|292492925|ref|YP_003528364.1| peptide methionine sulfoxide reductase [Nitrosococcus halophilus Nc4]
    MFKRHQKIEMPTAEEALPGRTEKMPVPERHYVSGHPLLPPFPKGMEQALFGMGCFWGAERKFWQTEGVYTTAVGYAGGHT
    PNPTYEQVCTGMTGHTEVVLVVYDPQVVSYASLLRIFWESHDPTQGMRQGNDLGTQYRSAVYIYNDKQKMAVESSKKIYE
    DKLQEAGYGPISTEIRPAPEFYYAEPSHQQYLAKNPHGYCGIGGTGVSCPL

    >gi|292492950|ref|YP_003528389.1| SNARE associated Golgi protein-related protein [Nitrosococcus halophilus Nc4]
    MGIFSMKRLGLIVLILILVGAFFYFEGPQYLDLDVLKAQQERLQQTIAGAPVVSVTVFFIAYVLVTALSLPGAAVMTIAG
    GALFGLLAGTLIVSFASTLGATLAFWSSRFLFRESLRQRYDKTVQRVDERMVVDGPFYLASLRLVPVFPFFVINIVMGLT
    GIRTWTFYWVSQLAMLPGTLVYVNAGTQLAAIKKVGDILSLPLLFSFLLLALFPLIAKFLLALLQRARLYKQFTKPKRFD
    YNLLVIGAGSAGLVSAYIGATVKAKVALIERDKMGGD
    CLNTGCVPSKALIQSSRIAEAMRQADRYGLPVVSPQIPFAPVM
    ERIQKVIKQVEPHDSVERYTRLGVDCIQGEATLISPWEVEVKGAEGSTRRVTAKATIIATGGRPFVPPIEGIDQVEPLTS
    DTIWQLRKLPQRLLVLGGGPIGCELAQAFARLGARVTLVEMGEQLLSKEDPDASAEVLRHFGKEGIEVKLQYKVARFGIE
    EGEKVAYCEHADGELGIPFDQVLVAVGRTANTENLGLENLGLKTGKGGTLPVEEDMSVCYPNLFACGDAAGPYQFTHVAA
    HQAWFAAANALFGNFKRFRVDYSVIPWVTFTSPEVGRVGLNETEAKEQGVEYEVTRYGLEDLDRAIAESEAYGYIKVLTP
    PGKDRILGATIVGPHGAELLTEFILAMKHKIGLNKILGTIHPYPTWNEAVKFTAGEWKKAHAPEKVLRWLERFHRWRIG

    >gi|292492956|ref|YP_003528395.1| pyridine nucleotide-disulfide oxidoreductase dimerization region [Nitrosococcus halophilus Nc4]
    MTSASVPTKDRFDVLVLGGGTAGSNAAQAACEAGASRVGMIYTPEMFNTCVQEGCMPSKSVLASSTQGHPFSEAIYRKDV
    HLTRLARALKGKMQRAPYALIEGSARFLPGPEGVEVTHEGKVRHLCARNYVIATGAHAWVPPIEGLERLPSGQVLISDDI
    VGIETLLGEAPKRLLVLGGGPIGLELATFFARVETEVLVVDISGLLEPFDPEFGQARLRALRATPHMDALVPGELQSVTD
    TANGVLCRIAHKGTLLERCVDRLLIAIGRKPNIETLALENAHVRVENSTIWHDEHLQTSNPQIYVAGDVVNHHQILHYAA
    EMGRVAGINAARSEPTMAMDYQKNALAVTFDEYPSALIGLTEKEAKAQGYDVISATQDLSSLGVGILEDLPWGLWKLVAD
    QAEGRILGSQIFGPSSAPELIHLLAPILYYRGTLQDIVHMTWYHPTYAELLRSLARKLCSETGIECPGA

    >gi|292492958|ref|YP_003528397.1| hypothetical protein Nhal_2950 [Nitrosococcus halophilus Nc4]
    MLANTLTATRLIIKKRRTRRIFLLSGILYFLLYLFAIGDLSFDTAPYNFAIRWSEQPFSLIFKPISPFYFEAIALIKLFF
    LVYLFSPINLFLALVLSCLVGFNITLSYLAFTQPKVCYGKPTAGILASLPALLVGSA
    CCGPLILIVLGIQASAALIAFFG
    WLIPIAILLLVGALIFNGHRMNISYLEDIQ

    >gi|292492973|ref|YP_003528412.1| methionine-R-sulfoxide reductase [Nitrosococcus halophilus Nc4]
    MKRIHILLLSLTLSISNTILAEDSEKKGFDPKTFTKPNPQEISARLTPRQYEVTQEDGTEPPFNNTYWNNKKPGIYVDII
    SGEPLFSSTDKYSSGTGWPSFTKPLNEKYIVTEEDWSFFMKRTEVRSKYADSHLGHIFNDGPPPTGLRY
    CINSAALRFIP
    VEKLQEEGYGEYLPLFEKDTQ

    >gi|292492979|ref|YP_003528418.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nitrosococcus halophilus Nc4]
    MVRTESMMLDLGTQAPDFQLPEPATGRTVSLADFKDAPGLLVIFMCNHCPYVKHISDGLAQFAREYQSKGLAIVAINAND
    VEHYPDDSPEKMAEEVKAQGYVFPYLYDDTQEVAKSYKAACTPDFFLFDKDCKLVYRGQFDDSRPRNDLPVTGKDLRAAV
    EAVLSGQPVPSEQRPSMGCNIKWKAGNEPDYFG

    >gi|292493145|ref|YP_003528584.1| protein of unknown function DUF395 YeeE/YedE [Nitrosococcus halophilus Nc4]
    MTEFTPVSGLIGGLMIGLSSVLMLLGMGRIAGISGIYSGLLTPAKGDLGWRIMFMGGLILGGVTWPLLTGSPFPVDLQVS
    WPIMLFAGFLVGFGTRLGSG
    CTSGHGVCGIGRLAPRSMIATLTFMTAAGMTTFVMRHLLGG

    >gi|292493170|ref|YP_003528609.1| glutathione-disulfide reductase [Nitrosococcus halophilus Nc4]
    MTSYDFDLFVIGAGSGGVRAARMSASFGARVAIAEERYLGGTCVNVGCVPKKLLLYGAHFSEDFEDAAGFGWRVGQCQFD
    WPTLIQNKNTEIERLNQIYESLLRKAGVTLVNGRACLETPHTVLVDGQRYTAERILIATGSWPAIPEFPGREHVITSNEA
    FFLDRLPRQVAIVGGGYIAVEFASIFNGLGSETTLLYRGPLFLRGFDEDLREGLAQEMAKRNIKLRFNTEVAAVEKEEQG
    FTVRLHHGEALKVDTVMYATGRTPNTRGLGLEELGVELSWNGAIVVNGDYQSAIPSIYGIGDVTHRINLTPVALAEAMVL
    ARNLYGGQYSQLDYDNIPACVFSQPNVATVGLTEEQARERCGEVSVYRSTFRPLKHTLSGRDERMMVKLIVEKATDRVVG
    AHMLGSDAGEIIQGIAVAIKAGATKTVFDNTLGIHPTAAEEFVTLRQPL

    >gi|292493183|ref|YP_003528622.1| peptide methionine sulfoxide reductase [Nitrosococcus halophilus Nc4]
    MVIAANKIIKQRLANSLIVLSLLAITSGRPALAVDDKDLAKATFAGGCFWCMEPPFDKLEGVISTTSGYIDGQLENPTYE
    EVSAGKTGHAEAIQVLYDPKKVSYAKLLEVFWHNIDPLTANRQFCDQGNQYRPAIFYHNEEQQRLAEESKTQLAHSGRFD
    QPIVTEIKPATPFYTAEKYHQNYYQKNPIRYKLYRFACGRDQRLQQLWGESD

    >gi|292493381|ref|YP_003528820.1| DSBA oxidoreductase [Nitrosococcus halophilus Nc4]
    MSRLTHWLLLSLSLLLISPAVAAAESSFTEGVHYKAVTPPLHPLQPGKAEVVEMFWYGCPHCYRFEPLLEQWAEAQPEQV
    AFIRVPAIFRDSWLLHAQAFYTAEALGVLDKVHRPLFDAIHLEKRPLKTKQEVANFFATLGVPKEDFLQTFESFAVQGKV
    QQAVVITRTSGITGVPAMIVNGKYRTDANMAGSFEDMLKVVDYLIAQGGPSSQAAAAK

    >gi|292493399|ref|YP_003528838.1| thioredoxin reductase [Nitrosococcus halophilus Nc4]
    MSETKHKHCRLLILGSGPAGYTAAVYAARAALDPVLVTGVEQGGQLMTTTDVDNWPGDDQGVQGPELMERMRKHAERFGT
    EIVFDQITEVDLSQLPFLLKGDSGHYTADALIIATGASAKYLGLPSEEAYMGRGVSA
    CATCDGFFYRGKPVAVIGGGNTA
    VEEALYLSNMADHVTVVHRRDRFRAEKILANRLLKKATESNVAIEWNHVLEEVLGDDAGVTGIRIKEVNTGQTKELPLHG
    VFIAIGHKPNTDIFTGQLEMEHGYILVRGGAKGFATQTSIRGVFAAGDVIDSVYRQAVTSAGTGCMAALDAEKYLDGLEE
    K

    >gi|292493528|ref|YP_003528967.1| cytochrome c biogenesis protein transmembrane region [Nitrosococcus halophilus Nc4]
    MRIFLAFTLMLLTGTSATAGLLDRLGFGETEKPPLLKVDQAFIYDAAVEDGNTLMARVNIVEGYYLYRDKFAFQILDAPG
    VSVSAVKLPPGKAKEDQFFGSTEVYEGKTEVQIPISLSRQGTAAETVTLEASLQGCSEIHGICYPPTTQKISLELPPPSA
    GGVSPIATDPGAAAGKTPDISLPSQDRIVQALFNDQSWLTLAAFFGFGLLLAFTPCVFPMIPILSGIIVGQGKNITTQRS
    FMLSLMYVLAMALTYTVAGIVAGLVGENLQATFQHPGILVGASLVFVLLALSMFDLYHFQLPTRLQNRLFHISQNQKGGT
    LLGAGLMGLFSALIVGPCVAPPLAGALIYIGESGDALLGGSALFALSMGMGTPLLVFGTSAGKLLPRAGGWMQPVKYLFG
    VLLLAVAIWLLSRILPHSVIMLLWGALFIISAVYLGALETLGADSIGWSKLWKGTGLISLVYGILLIVGAASGSGTEWQP
    LRGLTVARSADTPTAESLNFRSVKGPEGLQLALQEAGDRLVMLDFYADW
    CVDCKRMEVTTFSDPAVRNALRNTVLLQTDV
    TAYDAKDKALLNQFSLYGPPSVLFFGPDGTELKRVRLIGEASPKEFLKHLQQVNALLAQQTPKGARS

    >gi|292493529|ref|YP_003528968.1| Redoxin domain protein [Nitrosococcus halophilus Nc4]
    MNKIIRWPLILAAAVLASIGGYALYQAQQDNYPTTGPLRPVFQLPDVNGVEHDIREWDGKVLVINFWATWCPPCLKEIPE
    FIELQKSLGGKGLQFIGVAIDTPDKVKAFIEKHGINYPILVSQEKGTLVTTDYGNDLGVLPYTAFINRAGQITYTHAGAL
    DKETTKNFILPLL

    >gi|292493540|ref|YP_003528979.1| iron-sulfur cluster assembly accessory protein [Nitrosococcus halophilus Nc4]
    MSTTNAINAMPSPLIFTDAAASKVKELIEEEGNDKLMLRVFISGGGCSGFQYGFTFDETCHEGDTQVENGGVTLLIDPTS
    YQYLVGAEIDYTEGLEGAQFVIRNPNAATTCGCGSSFSV

    >gi|292493652|ref|YP_003529091.1| protein of unknown function DUF255 [Nitrosococcus halophilus Nc4]
    MPNPSVKNHLQGETSPYLLQHADNPVDWYPWSEEALARAHRENKPIVLSIGYSACHWCHVMAHESFESPEIAAAMNEHFI
    NIKVDREERPDLDQIYQLAQQMLTGRPGGWPLTMFLEPENQVPFFGGTYFPPEGRHGLPGFKDLLERIAEFFHAHREEIQ
    SQNSRLLAAFEELDTRTSAVEPEMLGPAPLKAAQQQLAQSFDPRYGGFKGAPKFPNPSSIERCLRDVRGEHLSAEARQKA
    LDLARLTLEQMAQGGIYDQLGGGFCRYAVDSQWRIPHFEKMLYDNGQLLALYADAYELWGSERCRRVLEETGHWAIREMQ
    SPEGGYYSSLDADSEGREGKFYVWTREQVQALLEEDEYPLVARYFGLDQPANFEGHWHLYGAITPEALAQELNLSPRILE
    ETLATAKQKLFAAREERIRPGRDDKILTSWNGLMIKGMAAAGQALAEPAFIASAERALDFVRGHLWREGRLLVSYKDGRV
    QHPGYLDDYAFLLDALLALLQARWREGDLAFAVELAEAALAHFEDPAQGGFYFTADDHETLIHRPVPLMDNATPAGNGVL
    AWSLQRLGHLLGEMRYLKAAERTLKASWASIQHTPHAHCSLLKTLEEWLYPPQMVILRGPEENLGSWRAIATGEYAPRRV
    SLAIPKGARDLWGQLEEYRPEGDRVTAYVCSGHTCSPPLTQQEAFKAHLADQGR

    >gi|292493688|ref|YP_003529127.1| thioredoxin [Nitrosococcus halophilus Nc4]
    MSDRIISVTDATFEEEVIKSEQPALVDYWAEWCGPCKMVAPILEEIAKEYEGKLKICKLNIDENPSTPPRYGIRGIPTLM
    LFKNGNVEATKVGALSKSQLAAFIDSNL

    >gi|292493707|ref|YP_003529146.1| Disulfide bond formation protein DsbB [Nitrosococcus halophilus Nc4]
    MGLSVRWTFFSGFLLCALMLAIAGYFQFVEGLEPCPLCILSRMVVLAIGGVFLVAAVHNPKGWGLKVYAWLGLVIALVGV
    GLSGRHVWLQNLPPDQVPS
    CGPGLSFILDNFPLAEALELVFRGSGECAEVQWSFLGLTIPGWTLVAFLFLGGVSLWQMRR
    TY

    >gi|292493729|ref|YP_003529168.1| thioredoxin [Nitrosococcus halophilus Nc4]
    MSDNNYIIHATESNFAEQVLAKSHQAPVLVDFWAAWCQPCQMLMPLLQQLAENYQGQFWLAKVNADEEQNLALQYGVRGL
    PTLKLFRHGEVVEELVGVQPESVIRAAIDRHLVRESERLLEQAQTALAAGQEEQGLHLLHKAAEIDPENYLVSVALAGAL
    LKQGKMTKAEQMLKALPLEVRGEEPASGLLAQIEFATLTEKAPDIHSLKQRLKANPEDSEARYLLGAQQALAGDYQDALE
    QFMVLLKQNPKYGDEAARKALLAVFNILGPDHELVPRYRRQMFRYLH

    >gi|292493741|ref|YP_003529180.1| Rhodanese domain protein [Nitrosococcus halophilus Nc4]
    MPYRTIISPTELARVLGNSNSVIFDCRFNLMDSSAGRYAYQQSHLPGAHYVHLEEDLSGPVTPATGRHPLPDPAQLAGKL
    GRWGVDSATQVIAYDDASGAFAGRLWWLLRWLGHEAVAVLDGGWQRWRGEGHPLTTELPESAAAHFETRVQPSMTVTTED
    VEHASLLGYLLLDGRTPERFRGELEPIDRVAGHIPGAKNHPFQQNLDEQGNFLSPRELALAFRAQMGEVPPEQIVCM
    CGS
    GVTACHNLLAMEIAGLQGARLYPGSWSEWITDGTRPVATGDEAHE

    >gi|292493823|ref|YP_003529262.1| Glutathione S-transferase domain protein [Nitrosococcus halophilus Nc4]
    MALSPSKRSVTILYSDPLCPRCHRTRIVVAEKNISTDIIDVEPDHLPEDLVQLNPYNSTPTLVDRDLVLYESKVIMEYFD
    ERFPHPPLMPVDPISRARIRLMLYRIDQEWYRLLGNAPRSSITPKVRKMLIEDLTVLTPVFEKTPFFMNEEFSLLDCTLA
    PLLWRLPALDIKLPPQAKLIEEYANRVFARDSFQKSLSNAEREIQAKTTSSI

    >gi|292492591|ref|YP_003528030.1| protein of unknown function DUF411 [Nitrosococcus halophilus Nc4]
    MRLIYQLSLGLLLVLLTMSSHAEESVWDKAQVSYFGPSNITVYRSPTCGCCKKWVEHLEKHRFTVKDITSNNMQTLKQQY
    GVPRELASCHTAIIDGYVIEGHVPADDIKRLLIEKPEIAGLTVPAMPVGTPGMEMGGRKDPFYVLQFNKEGQSKPFNAYR
    DY