Nitrobacter winogradskyi Nb 255 uid58295

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|75674237|ref|YP_316658.1| UBA/THIF-type NAD/FAD binding fold [Nitrobacter winogradskyi Nb-255]
    MRRLIDGENGRTMLSADELERYSRHIVMREVGGPGQNALRNARVLMIGAGGLGAPALMYLAAAGVGTLGVIDDDVVTLSN
    LQRQIIHATPDIGSPKVESAADKIRALNPHVAFRAHHMRLDASNAMALLADYDIVAEGSDNFATRYLVADACFLAKKPLV
    TAALGVFDGSLTTIRAHEKNADGVFNPTYRCLFPEPPPEGTVPS
    CQQAGILGALAGVLGSMTALEVIREIVGFGEGLVGR
    LLMVDARAMRFETLNYRRDPSNPLNGDHPTITDLSGYC

    >gi|75674250|ref|YP_316671.1| thioredoxin [Nitrobacter winogradskyi Nb-255]
    MAVGKVSDANFEAEVLKATGPVVVDFWAEWCGPCRMIGPVLDEISSAMGSKVKIVKLNVDESPRTASKYGVMSIPTLMIF
    KDGELASRQVGAAPKQKLEQWITATV

    >gi|75674260|ref|YP_316681.1| hypothetical protein Nwi_0061 [Nitrobacter winogradskyi Nb-255]
    MTADAPAPELAVSQWFNTAEPITLAALRGRPVLLHAFQMLCPGCVAHGTPQTQRAHELFKATDLQVIGLHTVFEHHAAMT
    PVSLQAFIHEYRLTFPIGVDAAGDGTPLPVTMGRYGMQGTPTSILIGRNGRIVHQGFGQQSDMALGAMIAAELAGAQTYA
    A

    >gi|75674298|ref|YP_316719.1| hypothetical protein Nwi_0099 [Nitrobacter winogradskyi Nb-255]
    MNQAAGSSGRLANRLSAETSPYLLQHQHNPVDWWPWGPEALAEAQRSNRPILLSIGYAACHWCHVMAHESFEDDDVAAVM
    NELFVCIKVDREERPDIDQIYMSALHHLGEQGGWPLTMFLSPDGSPFWGGTYFPKLPDFGRPAFTDVLQSVARVFRDQPD
    QIARHRDTLIARLSERATTKSPANLGVAELNNAAVAIMRSTDPVNGGLRGAPKFPQCSVLELLWRAGARTRDDRFFAATT
    LTLTRMSQGGIYDHIGGGYARYSVDDRWLVPHFEKMLYDNAQILDLLALDYARSKNPLYRERAIETVDWLRREMLTAEGG
    FASSLDADSEGEEGRFYVWSLSEIDDVLGAADAADFAARYDITANGNFERRNIPNRLKSIDVANDDSAHMRALRKKLLVR
    RESRVRPGLDDKILADWNGLMIAALVHGACVFDKPDWLRIARAAYDFIRTMMTRDGRLGHSWREGRLLIPALASDYATMA
    RAALALFEATGDGTFLEQALRWQSTLDTHYADAAHGGYYLTADDAEGLIVRPHSSEDDAIPNHDGVIAQNLVRLAALTGD
    AKWRDRIDSHFAALLPRATEKGFGQLSLMNALDLRLTGAEIVVAGEDAQAAALLGAARKLPYATSIVLHAPHADALPADH
    PARAKLSAVAQSAAFICRGQSCSLPVTQPDALNELM

    >gi|75674402|ref|YP_316823.1| methylated-DNA-(protein)-cysteine S-methyltransferase [Nitrobacter winogradskyi Nb-255]
    MAGRRRTSYILAMMTLAKIPAPADSRMTQPDAPGAALRDYDAVRRAIAFISENWRSQPAIAATADAAGVTPDELHHLFRR
    WAGLTPKLFMQALTLDHAKRLLRKSASVLDAALDSGLSGPGRLHDLFVTHEAMSPGEWKNGGSGMKLAFGFHPSPFGIAI
    VIASDRGLAGLAFADGGDEQAALADMKRRWPNAAYVEDAARTGALAQRVFDTRLWRADQPLRVVLIGTDFEVRVWQTLLR
    IPMGKVTTYSTIAASIDRPTASRAVGAAVGKNPVSFVVP
    CHRVLGKSGALTGYHWGITRKHAMLGWEAGRIGLE

    >gi|75674516|ref|YP_316937.1| periplasmic protein thiol-disulfide oxidoreductase DsbE [Nitrobacter winogradskyi Nb-255]
    MTDPEPPAAAPKRRWLMALPLVLFAALALLFWFRLGDRDISRIPSALIGRAAPQIPLPPLSGLMADGKPVPGIDPATFVG
    KVSLVNVWASW
    CVPCHSEAPLLTEFAKDRRVQFVGINYKDASDNARRFLGRYGNPFDVVGVDSNGRASIEWGVYGVPETF
    VVARDGTIAYKLVGEITPENIEAVLKPEIEKALKAGS

    >gi|75674623|ref|YP_317044.1| dihydrolipoamide dehydrogenase [Nitrobacter winogradskyi Nb-255]
    MTTYDLIIIGTGPGGYVCAVRAAQLGMKVAVVEKNPTLGGTCLNVGCMPSKALLHASEAFQEAGHSFARMGIGVSAPKLD
    LSAMMDFKQQGIDGNVKGVEYLMKKNKIDVLRGAGRVVAAGQVEVTGKDGKIQTAETKNIVIATGSDAAKLKGVEIDEKR
    IVSSTGALSLDKVPEKLLVVGAGVIGLELGSVWRRLGAQVTVVEFLDRILPGMDGEIAKQFQRILEKQGFAFKLGAKVTG
    VDTSGKTLSARIEPAAGGAAETIEADVVLVAIGRAPYTNGLGLKEAGVALDDRGRVEIDKHFATSVKGIYAIGDVVRGPM
    LAHKAADEGVACAEILAGQAGHVNYDVIPGVIYTTPEVSSVGKTEEELKQAGTAYAVGKFPFTANGRSKVNQTTDGFVKI
    LADAKTDRVLGVHIIGREAGELIHEACVLMEFGGSAEDLARTCHAHPTRSEAIKEAALAVGKRAIHM

    >gi|75674630|ref|YP_317051.1| OsmC-like protein [Nitrobacter winogradskyi Nb-255]
    MAYVTKATTKGGRNGRAILDDGGLGLAMALPKEMGGSGEGHNPEQLFALGWSSCFGQAVLALARKHGLDGQAAEIGCYVS
    IDKDEISFALKAELTLRIPGADKEKVKALLEDAHTI
    CPYSRATRNNVPVTLSVL

    >gi|75674658|ref|YP_317079.1| carboxymuconolactone decarboxylase [Nitrobacter winogradskyi Nb-255]
    MTRLPVHTAVTAPEAARERVQNAEKANGFLPNLIGLLANAPTALETYQTVSGINARAGLTLAEREAVQITAAITHGCGFC
    VAGHTAIAYKKADLKDAAVNALRDGVHGPDARLNAVADFTRAVIRSRGRVEDAELNAFRAAGFSDANALEVVLGVSLATL
    CNFANNLGQTDINPELKPYAWNNPTTVAAE

    >gi|75674689|ref|YP_317110.1| methylase involved in ubiquinone/menaquinone biosynthesis [Nitrobacter winogradskyi Nb-255]
    MSNPPLSEAGAATVEDQDGKARADYVLGHSDQELERLGSQGALFSDLTRDLLVRAGLKKGMRVLDVGCGVGDVSLIAAEI
    VSQSGSLKGIDPAAEALAIARMRLDAEGKSWASLSPGTLESLEDCSRFDAVIGRFILIHLANPAEALSRLRNRLRTGAII
    SFIEFDLSTAAVYPPLTLFQQ
    CLGWICEVYRRIGRQIDMGVALFSTFRAAGLTPQMAGLTRITTANEVALDFLVDSVRSM
    LPAIVKLGIAAEETVGIDTLRQRLLEEVASDEYCVFYPRLVGAWATVP

    >gi|75674768|ref|YP_317189.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Nitrobacter winogradskyi Nb-255]
    MAQEQAQPSGPDLTQGVDPGDFKDGKLVGHVGDQEILLVREGEGIFAIDAHCSHYHGPLADGIVVDGTVRCPWHHACFDL
    RTGEATCAPAFNALDVWQVEQRDGRIFVREKRARPAVRIAKPDHPGKIVIVGGGAAGFAAAEMLRRQDYAGSIVMLSSDD
    APPVDRPNLSKDYLAGSAPEDWLPLRPDDFYQQAGIDLRLRTTVTAIDPSARQLSINGDVIGYDRLLLATGAEPVRLPIP
    GANLSHVHTLRSLAD
    CRAIIDGAKSANRAVVIGASFIGLEVAASLRARGIEVHVVAPESRPMERILGAEMGDFVRSLHEE
    HGVIFHLENTVTAIGEKKVTISSGETLEADFVVFGVGVKPRLELAEKAGLKIDRGVLVNQYLETSAPGIFAAGDIARWPD
    PRFGENIRVEHWVVAQRQGQVAARNMLGHREKYDAVPFFWSQHYDVPINYVGHALKWDQIEVEGSVADRDCLLRYKHLGR
    VLAVSSIYRDVDHLKAEVAMERAVAA

    >gi|75674770|ref|YP_317191.1| methylated-DNA-(protein)-cysteine S-methyltransferase [Nitrobacter winogradskyi Nb-255]
    MTYGDIAKRLGGVELSRDVGQALGRNPCPIVVPCHRVLAAGDRPGGFSASDGVTTKLRMLAIEGAIVNHTPGLFD

    >gi|75674913|ref|YP_317334.1| thioredoxin-like protein [Nitrobacter winogradskyi Nb-255]
    MTDTPTPPHRAESRFPIGPLVAVAIVVGATVALLGIGHLRHAKSAVNALAPCGPAMELSRKLAPQATGEVASLTMASKPR
    RMPDLAFLDGEGQPMKLSDWKGKTVLLNLWATW
    CVPCRTEMPALDRLQGKLGGDKFAVVAINIDTRDSDKPKAFLKDANL
    THLGNFHDEKASVFQELKSVGMAVGMPTSVLIDGQGCELGNMAGPAEWDSEDAIKLINAAVGS

    >gi|75674938|ref|YP_317359.1| DSBA oxidoreductase [Nitrobacter winogradskyi Nb-255]
    MPESRDPFGAPTRRGLLRAFGLGMVTAGLTHAPTLAETPDNILTEARVLRDPEIPAAGNAQGDITIVEYLDFNCSYCRKL
    APGLAQVVRDDGKVRLIFKDWPILGPVSVYASRLALASRYQDKFVVAHEALINTRSRLTEPRVRALMADAKIDVDRAIKD
    MAANAGAIDAVLKRNNDQAAAFGFNGTPSFIIGKFRVPGVLTTAQFVQAIADARKAVAAKTR

    >gi|75675073|ref|YP_317494.1| hypothetical protein Nwi_0878 [Nitrobacter winogradskyi Nb-255]
    MATTVTQVTFDTPAPEFRLPATDGKTYGLDDLAGVNGTVVVFICNHCPYVKAVIDRMVADARVLMSEDIGFVAICSNDAA
    SHPEDSFENMKKFAETHGFPFPYLHDETQEVARAYGAVCTPDFFGYSADRKLKYRGRLDEGRKTPPRAEAPRELVEAMRA
    IARTGVAPADQNPSLGCSIKWKDS

    >gi|75675086|ref|YP_317507.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nitrobacter winogradskyi Nb-255]
    MSLLMNDERPRLTPSPFPLRMGDAAPDFEARSTKGPIRLSDYRGRWLVFFSHPADFTPVCTTEFVALAKAQDRFAALDCA
    LLGLSVDSLYSHLAWTRTITELFAVEIPFPVIEDPSMMVGRAYGMIDEAAESSASVRATYFIDPEGVIRAITHYPLTIGR
    SIDEMVRMVAALQATASSQKLAPANWRPGEPLLLPADEKTQKDVNWFCRSVA

    >gi|75675104|ref|YP_317525.1| heavy metal translocating P-type ATPase [Nitrobacter winogradskyi Nb-255]
    MNTAGRPGSKSGNGCGCSGEKQAASPAAASPESSCCGDREATHDHHAHDHDSDNHHEQHHGHADAMTDGKAVDPVCGMTV
    DPRTSKHRFDYQDTTYHFCCAGCRTKFAAAPRSYLDKSRAPPPADLPEGTIYICPMDPEVRQVGPGA
    CPICGMALEPELV
    SLDDAPNPELANMSRRFWIGLILALPVITLDMGAHIAGAHGWIDQTLSNWIQLAFATPVVFWAGWPFFVRGWQSLTTRNL
    NMFTLIAMGTGVAYLYSLAATMTPAIFPPAFRGADGAVAVYFEAAAVITILVLLGQVLELRAREATSGAIKALLDLAPKT
    ARRVDEQGADHDVALGEVAVGDRLRVRPGEKVAVDGLIIEGRSSLDESMVTGESMPVAREAGSKVIAGAINRSGSFIMRA
    EKVGRDTLLSRIVQMVAQAQRSRAPIQRLADRVAGWFVPAVIAAAVVAFAVWSFVGPEPRLAFGLVAAVSVLIIACPCAL
    GLATPMSIMVGVGRGAQAGVLIRNAEALERMEKVDTLVVDKTGTLTEGKPKVVAVEAVEGIEKDDLLRLAATVERSSEHP
    LADAIVAAATERGLALGEVQEFDAPAGKGVIGKVAGKTVLVGSAAFLESRNVAVRDMAPLADDLRDDGATVVNVAFDGRL
    AGLLAIADPVKASTRAALKALAGDGIRVIMLTGDNRTTANAIARQLGIADVEADVLPEQKSAVVARLQNEGRVVAMAGDG
    INDAPALAAADVGIAMGTGTDIAMESAGVTLLGGDLTGLVRARRLSEATMRNIRQNLFFAFMYNAAGIPIAAGVLYPVFG
    LLLSPIVAAAAMALSSVSVVGNALRLRATRL

    >gi|75675138|ref|YP_317559.1| hypothetical protein Nwi_0945 [Nitrobacter winogradskyi Nb-255]
    MSQLAEKSCVTPADAAAPIPFDNTYARMPEAFYERVKPAAVAAPRLLRVNDALARQLRIDPAFLKSPQGVAVLSGNEIAP
    GSDPIAQAYAGHQFGSFVPQLGDGRAILLGEVVDAAGKRFDIQLKGSGRTRFSRRGDGRAAIGPVIREYIVSEAMAALGI
    PTTRSLAVVLTGEQVMRERVLPGGILTRVASSHLRVGTFQYFAARGDVENLRALADYAIARHYPDVCSAGDPYLAFFDAV
    VATLARLSARWMLVGFIHGVLNTDNTAIAGETIDYGPCAFIDAYRPDKVFSSIDQFGRYAFENQPAAVAWNLARFAEALL
    PLIADGGAKAIECANASIAAFDDHFNAAYLSGMRRKLGLVREMEGDLELASDLLTRMSENGADFTLTFRALCGAADDTKG
    DAEVRGLFADPSAFDQWTERWRQRLSLEGQSAEVRRTDMLSVNPMFIPRNHRIEAAIRDAEAGRFETFHELVEVLSHPFD
    DQPKFAGYAKPPRPEEEVRQTF
    CGT

    >gi|75675164|ref|YP_317585.1| methionine sulfoxide reductase A [Nitrobacter winogradskyi Nb-255]
    MTVSTERAVLAGGCFWGMQALLRRYPGVISTRVGYTGGDVPDATYRNHGDHAEAIEVNFDPTVTSYRQLLEFFFQIHDPT
    TEDRQGYDQGLSYRSAIFYTNEEQKRIAEETIAEIDASGLWPGYVVTDVEPAGPFWEAEPEHQDYLERVPNGYTCHFVRP
    NWKLPRKQDAGQTAAGGDR

    >gi|75675282|ref|YP_317703.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Nitrobacter winogradskyi Nb-255]
    MSEAIKTDVLIIGAGPCGLFAVFELGLLDMKVHLVDILDKIGGQCAELYPEKPIYDIPGIPLVTGQGLTEALLEQIKPFN
    PTFHLNEMVESIEKIGDPGFRVTTDAGQVFECKVVVVSAGGGSFQPKRPPVPGIEAYENISVFYAVRKMEQFRDKEILIV
    GGGDSALDWTLNLHPLAKRITLLHRRDEFRAAPHSVEQMRKLVADGTMDLKIGQVTALEGADGKLTGAQVKGSDNTTSTV
    SCDTMLPFFGLTMKLGPVANWGLHLENNLIPVETASFETNVPGIFAIGDINTYPGKLKLILSGFHEGALMAQKAHRYVYP
    DKRLVFQYTTSSSSLQKKLGVN

    >gi|75675416|ref|YP_317837.1| glutathione reductase [Nitrobacter winogradskyi Nb-255]
    MADFDVDLFVIGGGSGGVRAARIAAGYGARVMVAEEYRMGGTCVIRGCVPKKLLVYGSHIRHDIEDAAGFGWSIPSATFD
    WPALIANKDREIARLEAAYTATLEKAGVQTVKSRAVFEDAHTLRLTTGETIRSKHVLIATGGRPNQGPAIPGIEHVISSN
    EAFHLDELPKRIAIQGGGYIALEFACIFAGFGSDVTLIYRGDNILRGFDDDVRAHVRAEMEKSGITILTDCTVERVDRHG
    DDFTSHLSNGSSVASDQVLFAIGRHPNVANLGLEKAGVAINPENGGIAVDGFSRTNVPHIYAVGDVTHRFNLTPVAIREG
    HAFADSVFGNKPTRVDHADIPTAVFSQPEVGTVGLTEAQARAEYAVDIYKATFRPLKATLSGRDTRMLMKLVVDATTDRV
    LGCHIVGDGAAEMTQVVGIAIRMKATKADFDATMALHPTAAEELVTMRTRTAHHARGAAE

    >gi|75675504|ref|YP_317925.1| glutaredoxin-like protein [Nitrobacter winogradskyi Nb-255]
    MSIKETIENELKSNDVVLFMKGTPQFPQCGFSGQVVQILDHVGVGYKGLNVLESPEMRDGIKTYSSWPTIPQLYVKGEFI
    GGCDIVREMFQAGELQKLLSDKGIAFNTPASA

    >gi|75675650|ref|YP_318071.1| alkylhydroperoxidase AhpD core [Nitrobacter winogradskyi Nb-255]
    MLDWANFRNKLSSRVGELRKLSPDTVDAYRMAGGAGAKTGHLDGKTRELISLAVAVTTRCDGCIAVHAAKAVQEGATREE
    IAEALGVAVAMNAGAAVVFSARVLDAVDAVEGAR

    >gi|75675851|ref|YP_318272.1| HesB/YadR/YfhF [Nitrobacter winogradskyi Nb-255]
    MTDMTPGTPATKPKPRPRPQVMRLTDAAATRVKELAARADSEIVGLRVGIKNGGCAGQSYTVEYAHDIRPTDEVVEDKGV
    KILVDPKAVLYLLGTEMDYKAEKMQAQFVFNNPNQVSACGCGESVQLTPAKIDG

    >gi|75675862|ref|YP_318283.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nitrobacter winogradskyi Nb-255]
    MSKKIRKKSSKSDSSVTVRAATVAHTEQAREAGPSPSPAATTKTKPRPAPPASQGAGLAEGSPAPPFNLPREDGALVSLA
    DFAGGKLVIFFYPRAGTPG
    CTIEAMDFTRLATDFAVSGTAVIGVSADPVKAQLSFRNKHQLSIALISDEKHQMLEAYGVW
    GEKSMYGKTFMGVLRTTVLVDGAGRIARIWRRVKVEGHADEVLAAAREL

    >gi|75675930|ref|YP_318351.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nitrobacter winogradskyi Nb-255]
    MTLSIGSTAPDFEAESTEGPISFHKWLGDSWGLFFSHPKDFTPVCTTELGAVARLKPEFDKRGVKLIGISVDPTDKHHLW
    SKDIEETQGVAPNYPLIADVDFKVAKLYGMLPASTSGDVNKRTPADNQTVRNIFVIGPDKQVKIVLIYPMSTGRNWQEVL
    RVIDSLQLTAKHGVSTPSDWKQGDDVFFSAAVPEEEARKKFPKGWKSPKPYFRIVEQPK

    >gi|75675942|ref|YP_318363.1| DSBA oxidoreductase [Nitrobacter winogradskyi Nb-255]
    MSSLRFLAPALLALAFSAPSAASAQSFSDSQRGEIEQIVKHYLLAHPEILEEVSAELSKRQAAAEALKHEAAVTENANAI
    FNSPRGVTLGNKNGDVTFVEFFDYN
    CGYCKRAMLDMLELMKSDPKLKVVLKEFPVLGQSSVEAAQVAVAARMQDPTGKKY
    LDFHQKLLGSRGQADKARALAAAKEAGFDMARIEKDMTSAEVRATLEENFKLAESMGMNGTPSYVIGKQVVVGAVGLENL
    KEKINTARCGKASC

    >gi|75676001|ref|YP_318422.1| HesB/YadR/YfhF [Nitrobacter winogradskyi Nb-255]
    MTEANITVSERAARRIREILKSEGDGAMLRISVEGGGCSGFQYKFDIERAKADDDLVIARDSAVVLVDPASVPFLSGSEV
    DFVDDLIGASFRVVNPNATASCGCGTSFSI

    >gi|75676005|ref|YP_318426.1| dihydrolipoamide dehydrogenase [Nitrobacter winogradskyi Nb-255]
    MADTHFDVIIIGSGPGGYVAAIRAAQLGLKTAIVEKQHLGGICLNWGCIPTKALLRSAEIYHYMRHAKDYGLSAEKVSYD
    PTAVVQRSRGVSKRLNEGVGFLMKKNKITVIWGEASVDAPGKITVKTSDPRIKTEPPKGVLGEGSYQAKHIVVATGARPR
    VLPGLEQDGKLVWTYFEAMVAPKIPKSLLVVGSGAIGIEFASFFRTMGAEVTVVEVLPQILPVEDAEIAALARKQFEKQG
    IRIMTSTKVTKLDRKADSVVATIDAGDGKPVAAEFERVISAVGVVGNIENLGLEKLGVKTDRGCIVIDGYGRTNVPGIYA
    IGDVAGPPMLAHKAEHEGVICIEAIKDLKPHPMDRSLIPGCTYCHPQIASVGLTEAKAKAAGKDIRVGRFPFAGNGKAIA
    LGEDQGLVKVIFDSKTGQLLGAHMIGAEVTELIQGYVVAMNLETTEQELMHTIFPHPTLSEMMKEAVLDAYGRALNM

    >gi|75676104|ref|YP_318525.1| arsenate reductase [Nitrobacter winogradskyi Nb-255]
    MPTMTVTIYHNPSCSKSRDTLAMIRQGGEEPVIIEYLKHPPDRSRLRALADAMGLPIRGLLRENGSPYEELDLGNPKWTD
    DQLLDFILAHPILLQRPIVETPKGVRICRPPERVLDLLTSPAAGEGGENTQR

    >gi|75676223|ref|YP_318644.1| hypothetical protein Nwi_2033 [Nitrobacter winogradskyi Nb-255]
    MTTTIYGIKNCDTMKKARAWLDDHGVAYDFHDYKTAGIDGVRLKGWAAKLGWEALLNRAGTTFRKLPDAKKAGLTEARAL
    ALMMEQPSMIKRPVLEAGDKLLVGFKPDIYEEQLRPLKVKR

    >gi|75676465|ref|YP_318886.1| OsmC-like protein [Nitrobacter winogradskyi Nb-255]
    MPHERFQFSGSGGHKLAATLDLPDSEPVAYALFAHCFTCGKDVLAARRIATGLTGRGIAVLRFDFTGLGASEGEFANSTF
    SSNIADLVLAADHLRQTRKAPALLIGHSLGGAAVLAAAARIPEAEAVVTIAAPSDPAHVTRLFADHVTDIHEQGAVEVSL
    AGRPFPISRQFLDDIAEHNLTEQIANLRRALLVLHSPTDDIVGIDNATRIFVAAKHPKSFISLAGADHLLSEKRDTGYVA
    EVIASWAQRYLEPRPASAAENPESRDVVVRETGRGKFQQTVTVGPHRLKADEPIPVGGDDTGPGPYDLLLAALGA
    CTSMT
    LRLYAERKALPLDRVTVRLRHSKVHAKDCAECETKTGTLDQIEREIAMEGTLDPDQRQKLIDIADKCPVHRTLTSEVRIT
    TRTASR

    >gi|75676637|ref|YP_319058.1| thioredoxin reductase [Nitrobacter winogradskyi Nb-255]
    MPAPIHAKVVIIGSGPAGYTAAIYAARAMLEPVLIQGIQPGGQLTITTDVENYPGFADVIQGPWLMEQMEKQAAHVGTRI
    VTDTVNSLDVSQRPFRLTCDSGEVYLAETVILATGAQARWLGLPSEDTFKGFGVSA
    CATCDGFFYRGKNVIVIGGGNTAV
    EEALFLTNFASQVTLVHRRDHFRAERILQDRAFKHPKIKVIWDSAIDEICGSEDPPKVTHVRLKNVKSGELTEVEADGVF
    IAIGHAPATELVTGKVKLKPSGYVEVAPNSTATSVPGLFAAGDVADEVYRQAVTAAGLGCMAALEAERFLAAHAGDRAAA
    E

    >gi|75676674|ref|YP_319095.1| rhodanese-related sulfurtransferase [Nitrobacter winogradskyi Nb-255]
    MSLMMDIAMNPTLDDPLVSTEWLAAHLGEVKAIDASFKMPGVLPLAVDDFYAAHIPGAVFFDVDAVSDRASPLPHMYPDA
    AQFGRDVGALGISSKDTVVVYDNGGWLAGPRAWWMFLSFGHAGVRVLDGGLKKWRAEGRPVESGKVSPEPGHFTATFDPL
    FVRDKAQLVSNLSSCREQLVDARAAARFTGAVMEPRQGLRSGHIPGSRNLSYAELFDPGTGVMKPLDDIRAAFSRAGVDL
    AKPVVTT
    CGSGVSAAVLTLALYRLGARGSALYDGSWSEWGLVEGPPIATGPA

    >gi|75676791|ref|YP_319212.1| protein-disulfide isomerase [Nitrobacter winogradskyi Nb-255]
    MIITRRAFNAALSLTGLAAVAGLSPWRFLGVAQAQNATAADVAKPVSLPDMALGPKDAAVTITEYASMTCPHCARFAEDV
    FPKIKTEYIDTNKIRYVFREFPLDIKAAAGAMLARCIAKDDAGKYFAVIDTLFKSQDTWTGSKTTESLKLIGKQTGLTEG
    EVENCLKDQALLDKIAADQKYANEVLKVNSTPSFFINGDMVKGEIAFEDFKNKIDPLLKK

    >gi|75676823|ref|YP_319244.1| glutathione peroxidase [Nitrobacter winogradskyi Nb-255]
    MASVFDFSANALDGQPCELKQFEGRVLLIVNTASACGFTPQYKDLEELHRTMSPRGFSVLGFPCNQFGKQEPGSAADIQQ
    FCASKYDVTFPMFEKINVNGADAHPLFRHLKSEKPGLLGESIKWNFTKFLVDRQGRVAARHAPTTNPKKLTEEIEALL

    >gi|75676870|ref|YP_319291.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nitrobacter winogradskyi Nb-255]
    MTIKVGDCLPNATFRIMTEDGVLTKSTDDIFKSKKVALFAVPGAYTGTCHKQHLPSIFASANAIKGKGVNEIAIVSVNDV
    FVMNAWKRDTDQRNEATFLADGNAEFAKAIDMTFDGSEKGLGIRSKRYSMLVEDGVVKTLNVEDSPGKVEVSGGDKLLGQ
    L

    >gi|75677085|ref|YP_319506.1| signal peptide protein [Nitrobacter winogradskyi Nb-255]
    MKHPLLLFAFVLAGAVLPQRLAAHDELRAFQRGSWQTILHAHAGRPMMVNFWGVTCGPCKVELPLLGKFVKDNPGVDVVT
    VNADLVPNAREAALSMLRKAGLSSTENWTFSDSFVERLRYEIDPAWQGDIPRTMLIARDGKITTIEGIVELAKVREWFAS
    QAVEADSESTRRTHN

    >gi|75677141|ref|YP_319562.1| methionine sulfoxide reductase B [Nitrobacter winogradskyi Nb-255]
    MRDSKAIPAKITKSDSEWRKELTPMQYAVLREKATEPPFSGEYEHERRGGTYVCAGCGQTLFESDAKFDSGCGWPSFTVP
    AVENHIDEERDISHGMVRTEVLCSRCNGHLGHVFNDGPEPTGLRY
    CINSAALKLEPK

    >gi|75677179|ref|YP_319600.1| rhodanese-like sulfurtransferase [Nitrobacter winogradskyi Nb-255]
    MLKVAALYQFTPLPDFRALREPLRELCAAHAIKGSILLAAEGINGTVAGTPRAIDALVSELQTGALFSGRLNDLELKFSQ
    ASAMPFARLKVRLKKEIVTLGDPATDPTRAVGIYVDPQDWNELIATPDTILLDVRNDFEVVMGSFEGAIDPQLARFGQFK
    DFAAQELDHRKHRRIAMY
    CTGGIRCEKASSYLLSRGFKEVYHLKGGILKYLEQIPESESRWRGECFVFDDRIALGHGLKE
    SRQASPVMDGAPHDD

    >gi|75677303|ref|YP_319724.1| arsenate reductase [Nitrobacter winogradskyi Nb-255]
    MDVIIYHNPDCGTSRNTLALIRNAGIEPHIIEYLKTPPLRVLLAQLIARMGISARALLRDKGIPYTELGLADPKLTDDQI
    LDAMMAHPILINRPIVVSPKGVKLCRPSEDVLDLLPPQQGELTKEDGERVIDEQGRRIATA

    >gi|75677312|ref|YP_319733.1| heavy metal translocating P-type ATPase [Nitrobacter winogradskyi Nb-255]
    MATASPLKLRIEGMDCGACAAKIENAMQRLPGVSDINVNYGLQSLSLAVDEDRTSRTTIEAKIRALGYTPADPSEHVMSS
    SRRDDDRDSAEGTWWSSSKGRLVIGTGALLLLAFAVSYIEPDWSNWAYIAATLVGLIPIGRRALAGALSGTPFSIETLMS
    IAAIGAVAIGEAGEAAVVVFLFAVGELLEGVAAGRARAGIKALIDLVPRTARRQTGSDIETVPVGDLVVGDAVIVRPGDR
    VPSDGTVIEGVSEVNEAPVTGESVPVGKEPGSTVYAGSINANGELRVKITRTAADNTIARIVHMVEEAQGSKAPTARFID
    RFSRWYTPAAMAVSALVVLVPPLMFGADWFTWVYRGLAVLLIACPCALVISTPAAIASGLASGARRGLLIKGGAALETLG
    KVRTVAFDKTGTLTMGHPQVTDIVVIEGTEADILAKSAAVERGSSHPLGAAIVAEAERRGLEIPKAFGGGIATPGKAVTA
    RLKAGFVSVGSPRHASEQGEVPEKVRKQIEALESQGKTVVVVSEGKQLVGLIALRDEPRPDAADGLAKLRALGIRPVMLT
    GDNARTAAAIGDALGLEIRAELLPDAKLDAISVYKSEGPIAMVGDGINDAPALAASSVGIAMGGGTDVALETADAALLKN
    RVTGVAELIALSRATLANIWQNIMLALGLKSVFLVTTLFGATPLWMAILADTGATVLVTANALRLLRLEFKA