Nitrobacter hamburgensis X14 uid58293

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|92109446|ref|YP_571734.1| alkylhydroperoxidase AhpD core [Nitrobacter hamburgensis X14]
    MSDLTYPKPTRELAEMRRSLNPEAEAAFQAFSKAVFSDGALSGKTKQLIAVAVAHVTQCPYCITGHTKAARRAGATPQEL
    MEAVWVAAEMRAGGAFAHSTLMLSTLESPLS

    >gi|92109516|ref|YP_571803.1| copper-translocating P-type ATPase [Nitrobacter hamburgensis X14]
    MTSPEKANSKGECGCSSKASAAPGPDETKAACCGDGHGGHDHDAHEHRHHPVSGDGKVVDPVCGMTVDPTSSKHRFDYQG
    HTYHFCSAGCRTKFAAAPETYLDKSKATPKDPVPEGTVYTCPMHPEIRQIGPGS
    CPICGMALEPEVATLDAAPNPELADM
    TRRFWIGLVLALPAVVLEMGGHLVGGHGWVDQTLSNWIQLVSATPVVIWAGWPFFVRGWQSLVTRNLNMFTLIAMGTGVA
    YVYSLVATVAPQVFPPAFRGHDGAVAVYFEAAAVITVLVLLGQVLELRAREATSGAIKALLDLAPKTARLVAEDGTDHEV
    PLDGLNVGDRLRVRPGEKVPVDGVILEGRSSVDESLVTGESMPVTKEIDAKVIAGTLNQSGSFVMQAEKVGRDTVLSQIV
    QMVAQAQRSRAPIQRLADQVAGWFVPAVIGAALVAFAVWALVGPEPRLAFGLVAAVSVLIIACPCALGLATPMSIMVGVG
    RGAQVGVLIKNAEALERMEKIDTLVVDKTGTLTEGKPKVVSIVASAGFREDDLLRFAASVERASEHPLADAIVRAAKERD
    LSLANVEEFDSPTGKGVTGKVDGKNILLGNVGYLQSLGVETQSMEAQAEALRGDGATVINIAVDGKLAGLFAIADPIKPS
    TPDALRALAADGIKVIMLTGDNRTTANAVAKRLGISEVEAEVLPDQKSAVVSKLQKAGRIVAMAGDGVNDAPALAAAEVG
    IAMGTGTDVAMESAGVTLLKGDLGGIVRARLLSEATMANIRQNLFFAFIYNAAGIPIAAGVLYPVFGLLLSPIIAAAAMA
    LSSVSVVGNALRLRMVKL

    >gi|92109547|ref|YP_571834.1| mercuric ion transport protein, MerT [Nitrobacter hamburgensis X14]
    MTSRESDSSRDVTRLQNAAAAGGVLGAVAASSCCMLPLLLFTLGASAPWIGTLVRLAPYQPYFIALAVACLGCGYWLWHR
    SSNQKRDAACSIRSASKFVNPALVVATILVVAAIAFNVLWPVLTS

    >gi|92109549|ref|YP_571836.1| thioredoxin/glutaredoxin [Nitrobacter hamburgensis X14]
    MKVEMFYSPGCSECVAAHARLRTTAQEAVKNLVWRELNVLDELDYAVELGVLTLPSIAVDGKLIFTSMPTVAQLRTALIE
    RSKGRE

    >gi|92109553|ref|YP_571840.1| heavy metal transport/detoxification protein [Nitrobacter hamburgensis X14]
    MKTTTFKIEGMNCDACANTIKKLVEKEPGVRVAEVSFDEGSARILYDPQSVEEERLVDTIQKPGFRVVARG

    >gi|92109558|ref|YP_571845.1| arsenate reductase [Nitrobacter hamburgensis X14]
    MTITIYHNPDCGTSRNTLAMIRQSGIEPEIIEYLKQPPSREKLIELMTRMGISPRDLLRQKGTPYDDLELADLRWTDDEL
    IDFMIAHPILINRPVVVTPKGVKLCRPSEEVLSILPNPHIGRFVKEDGEIINAN

    >gi|92109658|ref|YP_571945.1| heavy metal translocating P-type ATPase [Nitrobacter hamburgensis X14]
    MSDFAQPTKIRLRVEGMDCASCATKIENALQRLPGVQEVFVSIPAGTVIVSHDGSEADDGIRQRVSDLGYRVAQVDAAGS
    SNHRQQQADDEASHAEDGPSHLHEHTSGGGPWWRTRKGILTIASGLALAVAYVLGKAVPTEHWAFLLAMLVGLVPIARRA
    VSAARVGTPFSIEMLMSVAAIGAVVIGATEEAATVIFLFLIGELLEGVATSRARASIQDLTRLVPKTARVEEDGQVREVQ
    AETLAVGALIQIRPGDRIPADGMIVSGQSAIDEAPVTGESTPVRKRPDDTLFAGTVNGDGLLRVRVTAAAADNTIARVVR
    LVEEAQESKAPTERFIDRFSRIYTPGVVAVAILVAVVPPLLFGGVWSNWIYKGLAILLIGCPCALVISTPAAIAASLSAG
    ARRGLLLKGGAVLEQVGKVTMACFDKTGTLTAGKPQVTDVIGLARSENDVLRFAAALEAGSSHPLATAILAEAHKRDIPI
    PATSESEAVGGKGIRARVDGLHVFLGSPSAAAEIVSLKPDDELRFAGLNDEGKTVSVLLIGQLLAGAIAMRDEPRPDAEK
    GLRLLSKAGIKAVMLTGDNLRTATAVGKQLGIDVQAGLLPQDKQRIVAQFRNKGWTVAKIGDGINDAPALAAADVGIAMG
    GGTDVALETADAAVLHGRVSDIAAMVDLSKRTMVNIRQNIAVALGLKAVFLVTTIVGLTGLWPAILADTGATVLVTLNAL
    RLLAPSGANEADEK

    >gi|92109727|ref|YP_572013.1| rhodanese-like protein [Nitrobacter hamburgensis X14]
    MATKRAKDLVAEANRNVETLSGAEAEKLVSDSDVVFVDIRESDELQKTGTLKGALHVPRGFLEFQADPTSPTHKPELGGG
    KKLVLY
    CGSGSRSALGANTLMEMGIINIAHVAGGFPALQQAGAPCEEAKQ

    >gi|92109731|ref|YP_572017.1| protein of unknown function DUF395, YeeE/YedE [Nitrobacter hamburgensis X14]
    MDNFTPFSALAGGSLIGLAAALLLLLNGRIAGVSGILGGIIGAIVPEATWRVAFIAGLVLSSVVYAASGATLPRISIDHS
    VGALIIAGLLVGFGTRLGSG
    CTSGHGVCGMARGSRRSLVATAVFMGTSILTVFVARHVIGG

    >gi|92109746|ref|YP_572032.1| UbiE/COQ5 methyltransferase [Nitrobacter hamburgensis X14]
    MAAAIEPRRVCRRPFGLSYAAMPDCSSMAQLAGPQGHVVGIDATPEQLAIARAHENWHRDRFGYPKSTVTFVEGDVSRLD
    ELSFDNDSFDLIVSNCVINLIPDKAAVFAAAYRLLKKGGELYFSDIYSDRRVPAVLRANPILHGE
    CLAGALYWGDFLNLA
    KSAGDPRLVSDRSLGINDLEIAELVGPVEFYSATYRLFKLDGLESACEDYGQAVRYRGTVPEAVHNFVLDKHHDIDAGRL
    FPV
    CGNTYRMLQESRLAPHFEFFGDTNRHYGIFKGCGTDLPFSREAQRAVAGGSCC

    >gi|92109747|ref|YP_572033.1| putative thiol--disulfide interchange redox-active center transmembrane protein [Nitrobacter hamburgensis X14]
    MRIATAVLVSVAATLSSATAHPESLDPPTLRNGISQFVLEEPLRPAPLMRLRGLDGRTLSMDKFYGKVVLLNFWASWCAP
    CVEEMPSLEALAASLPSDRFVVVAVSLDSGDGRQVKSFVKRHNLRHLTVVRDPNHEFGALTSEGKPEPTMPVYGYPTTYI
    LDKRGLVTGFLVGPTTWDSPLARSFIDYFINLK

    >gi|92115678|ref|YP_575407.1| UBA/THIF-type NAD/FAD binding fold [Nitrobacter hamburgensis X14]
    MLSADELERYARHIVMREVGGPGQNALRNARVLMIGAGGLGAPALMYLAAAGVGTLGVIDDDVVTLSNLQRQIIHATSDI
    GSPKVESAADKIRALNPHVAFRAHNMRLDAANAVALFADYDIVADGSDNFTTRYLVADACFLAKKPLVTAALGVFDGSLT
    TIRGHEKNADGEFNPTYRCLFPEPPPEGTVPS
    CQQAGILGALAGVLGSMTALEVIREIVGFGEGLVGRLLMVDARAMRFE
    TLNYRRDPSNPLNGDHPTIRDLSGYR

    >gi|92115691|ref|YP_575420.1| thioredoxin [Nitrobacter hamburgensis X14]
    MAVGKVSDANFEAEVLKATGPVVVDFWAEWCGPCRMIGPVLDEISGAMGDKVKIVKLNVDESPRTASKYGVMSIPTLMIF
    KGGELASRQVGAAPKQKLEQWITATV

    >gi|92115701|ref|YP_575430.1| hypothetical protein Nham_0069 [Nitrobacter hamburgensis X14]
    MTGADVPAPELAVSQWFNTGEPLTLAALRGRPVLLHAFQMLCPGCVAHGTPQTQRAFELFKATDLQVIGLHTVFEHHAAM
    TPVSLQAFIHEYGLTFPIGVDAAGEGTPLPVTMSRYRMQGTPTSILIGRDGRIVHHGFGQQSDMALGAMIAAELAGAQTY
    AAKA

    >gi|92115713|ref|YP_575442.1| thioredoxin-related [Nitrobacter hamburgensis X14]
    MSIVEQGSGPPPQASNLIRETTAQTFMNDVVEESMRQPVLVDFWAPWCGPCRQLTPILEKAVLAGGGKVKLVKMNIDQHP
    AIFQQLAAQIGNQSIPAVFAFTGGRPVDYFTGAAPESQVNAFIDKLTQGMAAPGAPNIEEILQEAEAALVAGDPATAASI
    YAEVVGFDAANLPAIAGLARCYATTGALDKAKQTLALVPESKRGDAAVATVQAMIDLAEQASSLGPVADLERKVAENPLD
    HQARFDLATALNASGNRNDATGHLLEIVKRDRKWNDDAARKQLVQFFEAWGAADEATVEGRKRLSTILFS

    >gi|92115739|ref|YP_575468.1| hypothetical protein Nham_0107 [Nitrobacter hamburgensis X14]
    MNHAATGSGRPANRLAAETSPYLLQHQHNPVDWWPWGPAALAEAQRTNRPILLSIGYAACHWCHVMAHESFEDDEVAAVM
    NELFVCIKVDREERPDIDQIYMNALHLLGEQGGWPLTMFLSPDGSPFWGGTYFPKLPDFGRPAFTDVLQSVARVFHDKPE
    RVTLNRDAVIARLSERAKVGSPANLGVAELNTAAVSIARSTDPVNGGLHGAPKFPQCSVLEFLWRAGARTGSDRFYAATT
    LTLTQMSQGGIYDHLGGGYARYSVDDRWLVPHFEKMLYDNAQILDLLALDYARSKNPLYRERAIETVAWLLREMLTGEGG
    FASSLDADSEGKEGKFYVWSLSEIEEVLGATDAADFAARYDITANGNFEGRNIPNRLKSSDLVSDDGAHMRTLRAKLLAR
    RAGRVRPGLDDKVLADWNGLMIAALVHGACAFGLPDWLETARTAFEFIRKTMTRGDRLGHSWREGRLLVPALACDYAAMV
    RAALALSEATGDTAYLEQALRWQATLDTHYADVEHGGYYLTADDAEGLIVRPHSTIDDAIPNYNGLIAQNLVRLAALTGD
    SKWRDRIDALFGALLSRAAENGFGHLALLSALDLRLTGAEIVVVGEGAQAEALLAAARALPHATSIVLHVSRGDALPAEH
    PARAKADSVQGAAAFVCRNQSCSLPVTTPQALVDLVMQRTSA

    >gi|92115792|ref|YP_575521.1| AraC family transcriptional regulator [Nitrobacter hamburgensis X14]
    MAATQPPPYIRVMMTFAKSFAPNDPRLTLPGAESAALRDYDAVRRAIAFISANWRTQPTIAAIADAAGVAPDELHHLFRR
    WAGLTPKAFMQALTLDHARGLLRKSASVLDAALDSGLSGPGRLHDLFVTHEAMSPGEWKNGGAGMRLAFGFHPSPFGTAI
    VIASSRGLAGLAFADAGEEQTALADMKRRWPNATYVEDHAGTAALAQRVFDTKLWRPDQPLRVVLIGTDFEVRVWETLLR
    IPMGKATTYSSIAANVNSPKASRAVGAAVSKNPVSFVVP
    CHRVIGKSGALTGYHWGITRKQAMLGWEAGQVGVE

    >gi|92115817|ref|YP_575546.1| glutathione S-transferase-like [Nitrobacter hamburgensis X14]
    MFTLFHHPFCPQSRFIRLALGEHGLDVRPVEERVWERREAFLALNPAGTTPVLIAEGVPAVPGAAIIADYLDETYGERIG
    DRRLLPTTMPERIEVRRLMAWFNEKFFEEASGPLVTERIYKRFMGEAIGGGSPETDVMRAARTNVRYHLAYIGWLARTRN
    YLAGDRLTYADLAAAAHLSAIDYLGDVPWAEDDAAKAWYARIKSRPSFRPLLSEWLAGVPASRTYVDLDF

    >gi|92115856|ref|YP_575585.1| OsmC-like protein [Nitrobacter hamburgensis X14]
    MDAAELRATQAPIKKRYKTDPKSALITLKARGSIENEGIACKIDTGRALTVAGLHPATGGSGLELCSGDMLLEALVACAG
    VTLKSVATAIDVPLKSGHVTAEGDLDFRGTLGVDKETPVGFESIRLRFDVATDAPQDKLDLLLKLTERYCVVYQTIRNGP
    KVSVEMKRV

    >gi|92116035|ref|YP_575764.1| periplasmic protein thiol [Nitrobacter hamburgensis X14]
    MTDPAIPAAAPKRRWLMALPLVVFAALALLFWFRLGDTDISRIPSALIGHAAPRTTLPPLSGLVADGKPVPGLDPASLEG
    KVSLVNVWASW
    CVPCHGEAPLLTALAKDRRLQFVGINYKDAPDNARRFLGRYGNPFDIVGVDDNGRASIEWGVYGVPETF
    VVGRDGTIAYKLVGAITPENIDAVLKPEIDKALKAGS

    >gi|92116151|ref|YP_575880.1| OsmC-like protein [Nitrobacter hamburgensis X14]
    MAYVTKATTSGGRNGRAVLDGGGLALAMALPKDLGGAGDGHNPEQLFALGWSSCFGQAILVLAKKHGLDGQAAKVTCEVT
    LNINDGAFSLAAELKVALPGADKAKLQALIEDAHTI
    CPYSKATKGNVPVKLTAV

    >gi|92116158|ref|YP_575887.1| dihydrolipoamide dehydrogenase [Nitrobacter hamburgensis X14]
    MAKLPDDNTRFETMATYDLIVIGTGPGGYVCAIRAAQFGMKVAVVEKNPTLGGTCLNVGCMPSKALLHASEMFEEAGHSF
    AKMGIGVSAPRLDLAAMMNFKQQGIDGNVKGVEFLMKKNKIDVISGTGRILGAGKVEVTGNDGKKQTLETKNIVIATGSD
    VAKLKDIEIDEKRIVSSTGALSLAKVPGKLLIVGAGVIGLELGSVWHRLGAQVTVVEFLDRILPGMDGEVAKQFQRMLEK
    QGFAFKLGAKVTGVDTSGKTLTAKVEPAAGGAAETIEADVVLVAIGRTPYTDGLGLKEAGVALDDRGRVEIDAHFATNVK
    GVYAIGDVVAGPMLAHKAEDEGVACAEILAGQAGHVNYDVIPGVIYTTPEVSSVGKTEEELKQAGTAYTVGKFPFTANGR
    SKVNQTTDGFVKILADAKTDRVLGVHIIGREAGEMIHEACVLMEFGGSAEDLARTCHAHPTRSEAIKEAALAVGKRAIHM


    >gi|92116281|ref|YP_576010.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Nitrobacter hamburgensis X14]
    MAEDQAPPSGPDLAQGVDPGAFKDGKLVGHVGDREILLIRDGTEIFAIDAHCSHYHGPLADGLVVDGAVRCPWHHACFDL
    RTGEAIRAPAFNALDVWEVEQRDGLIFVRGQRERPAAKVAKPDHPENIVIVGGGAAGFAAAEMLRRQDYKGGIVILSSDD
    AAPVDRPNLSKDYLAGSAPEDWLPLRPDDFYQQAGIDLRLRTTVTAIDPKARQLTTTGGGIGYDRLLLATGAEPVRLPIP
    GANLPHVHTLRTLAD
    CRAIIDAARTAQRAVVVGASFIGLEVAASLRARGIEVHVVAPESRPMERILGAEMGDFVRALHEE
    HGVIFHLEDTVAAIGERKVTLGSGGSLEADFVVFGVGVKPRLELAEKAGLTIDRGVLVNEFLETSVPGIYAAGDIVRWPD
    PHAAENIRVEHWVVAQRQGQVAARNMLGHREKYDAVPFFWSQHYDVPINYVGHALKWDQIEVEGSVADRDCLLRYKHQGR
    VLAVSSIYRDIDHLKAEVAMERAVAS

    >gi|92116282|ref|YP_576011.1| methylated-DNA--protein-cysteine methyltransferase [Nitrobacter hamburgensis X14]
    MSEDVRDIKFALFDTAIGACGIVWTARGIKAVQLPLSDEDKTRTRIRQRYGRLAEAIPPAGVQTAIDGMIALLEGKPKDL
    SDVVLDLDGVCEFDLGVYDIARTIPPGRTMTYGDIARRLGGVELSRDIGQALGRNPCPIVVP
    CHRVLAAGDKPGGFSANG
    GVATKLKMLAIEGAAVNHTPSLFD

    >gi|92116532|ref|YP_576261.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nitrobacter hamburgensis X14]
    MALLMNDVTPRPAPSPLRMGDSAPDFEARSTKGPIRLSDYRGRWLVFFSHPADFTPVCTTEFVALAKARDRFTALDCALL
    GLSVDSLYSHLAWTRTITELFAVEIPFPVIEDPSMMVGRAYGMIDEAAENSASVRATYFIDPEGVIRAITHYPLTIGRSI
    DEMVRMVAALQATMSGQKLAPANWQPGETLLLPADEKTQKDTNWFCRSAA

    >gi|92116602|ref|YP_576331.1| putative signal peptide protein [Nitrobacter hamburgensis X14]
    MKRQLLFAVAFVWALLPQHLAAHDQLHAFQRGSWQAILHAHAGRPTMVNFWGVTCGPCKVELPLLGKFVKDNPGVDVVTV
    NADLVPNAPEATLSMLAKAGLSSVENWTFSDGFVERLRFEIDPNWQGDIPRTMLIARDGKVTIMEGIVDFADVRKWFDAQ
    PIEAR

    >gi|92116706|ref|YP_576435.1| methionine sulfoxide reductase B [Nitrobacter hamburgensis X14]
    MPDSKTMPPKITKSDSEWRKELTPMQYAVLREKATERPFSGEYEHERRKGTYVCAGCGQTLFESDAKFDSGCGWPSFTAP
    AADSQVDEERDVSLGMIRTEVLCSKCDGHLGHVFDDGPGPTGLRY
    CINSAALKLEPK

    >gi|92116707|ref|YP_576436.1| methionine sulfoxide reductase A [Nitrobacter hamburgensis X14]
    MTRNPFGRNALVAAAVAGTVALSWLLTGASRAAGDAVIIPPPALDAKAADGIQTAVVAGGCFWGVQGVFQHTAGVANAVS
    GYAGGAKETAKYETVSTGTTGHAESVEIKFDPKQISYGKILQIFFSVVHDPTQLNRQGPDTGTQYRSEVFTLNGEQKKVA
    DTYIAQLDAARVYNKPIVTKVGTLQGFFPAEAYHQDYLTRHPNQPYIAYYDLPKIRNLKTIFADNYIEKPTLVSSVKTTD


    >gi|92116877|ref|YP_576606.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Nitrobacter hamburgensis X14]
    MSEAIKTDVLIIGAGPCGLFAVFELGLLDMKVHLVDILDKIGGQCAELYPEKPIYDIPGIPFVTGQGLTEALLEQIKPFN
    PNFHLNEMVESIEKIGDPGFRVTTDAGKVFECKIVVVSAGGGSFQPKRPPVPGIEAYENTSVFYAVRKMEQFRDREILIV
    GGGDSALDWTLNLHPLAKRITLLHRRDDFRAAPHSVEQMRKLVADGKMDLKIGQVTALEGADGQLSGAQVKGSDNAMSTV
    SCDTMLPFFGLTMKLGPVANWGLQLENNLVPVETASFETNVPGIFAIGDINTYPGKLKLILSGFHEGALMAQKAHRYVYP
    DKRLVFQYTTSSSSLQKKLGVN

    >gi|92116885|ref|YP_576614.1| methionine sulfoxide reductase B [Nitrobacter hamburgensis X14]
    MIDRRILLASAAGLAGLSGFHWLRGEPARATGTKPARKFEIEKTDAEWRAQLTPAQYNILRKEGTEPPFTSPLLKEHRKG
    TFACAGCDLPLYSSETKFESGTGWPSFWKPLPNAVGETRDTTFGMARTEIHCRRCGGHLGHVFDDGPKPTGLRY
    CMDGLA
    LVFHPSAPSAT

    >gi|92117035|ref|YP_576764.1| glutathione reductase [Nitrobacter hamburgensis X14]
    MADFDVDLFVIGGGSGGVRAARIAAGHGARVMIAEEYRMGGTCVIRGCVPKKLLVYGSHIRHDIEDAAGFGWSIPSARFD
    WPTLIANKDKEIARLEAAYTSNVEKAGARVVKTRAVFEDPHTLRLATGETIRSKHVLIATGGAPNHGRAIPGIEHVISSN
    EVFHLAELPKRIAIQGGGYIALEFACIFAGFGSDVTLIYRGDNILRGFDDDVRAHVRAEMEKDGITILTGCTVDRIDRHG
    DEFTSHLSNGSSVASDQVLFAIGRHPSVANLGLENAGVAINPNNGGIAVDGFSQTNVPHIYAVGDVTHRFNLTPVAIREG
    HAFADTVFGNKPTRVDHADIPTAVFSQPEVGTVGLTEAQARVQFTNVDIYKTTFRPMKATMSGRDTRILMKLVVDATTDR
    VLGCHIVGDGAAEMVQVLGIAIRMKATKADFDATMALHPTAAEELVTMRTPTARYVREAAE

    >gi|92117132|ref|YP_576861.1| alkylhydroperoxidase AhpD core [Nitrobacter hamburgensis X14]
    MMFDWNEYKKQLSGRIGEIGKISPSITRGYSEISGASAQTGKLDDKTRELIALAVAVTRQCDGCIAVHTDAAIKYGATRE
    EVAEALGVAIAINAGAALVFSARVMDAYDAIAKA

    >gi|92117133|ref|YP_576862.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Nitrobacter hamburgensis X14]
    MDFNRNIGPRRPFFFGPDQTQSSGSRTVNPPHIVIVGAGFGGLEAAKALARTPAAVTIIDRQNHHCFQPLLYQVATAALS
    PADIAWPVRSILSRQSNARVVMAEVSGIDLSARQVITNSMPPLPYDFLVLATGAMHSYFGHDEWAPFAPGLKRVEDATEI
    RRRLLIAFEKAEVAIDARERQDLLSFVIVGGGPTGIELAGAAAEIARYALVRDFRCIDPRASRIVLVEAGPRILPALPEA
    LSAYAQSSLERMGVTVRTSTMVTACDEKGVVVATGERIPALTVIWAAGVKASPAAAWIKADCDRAGHIKVNPDLSIPDQP
    NVFAIGDTATVFWNERTVPGIAPAAKQMGRYVGQLVARRIAGRAEPRAFNYRHYGDLATIGRKSAVVSIGRLRLKGWIAW
    VFWSVAHIYFLIGARNRLSVAFDWLWDYLTFQRGARLIIQAPNSTAAVERRGGGHVIETASTPATSPVDLSRKREVKSRR
    IPRKREPL

    >gi|92117191|ref|YP_576920.1| glutaredoxin-like protein [Nitrobacter hamburgensis X14]
    MMSIKDFIETELKSNDVVLFMKGTPQFPQCGFSGQVVQILDHVGVGYKGLNVLESPDLRDGIKTYSNWPTIPQLYVKGEF
    VGGCDIVREMFQAGELQKLLTDKGITLSAPASA

    >gi|92117219|ref|YP_576948.1| hypothetical protein Nham_1671 [Nitrobacter hamburgensis X14]
    MTITIYGIKNCDTMKKARAWLDGHSIAYDFHDYKTAGVDRARLKGWAAKLGWETLLNRAGTTFRKLSDADKAGLNETKAL
    ALMLAQPSMIKRPVLEAGDKLLVGFKPEVYEEELRAPKTKR

    >gi|92117298|ref|YP_577027.1| dihydrolipoamide dehydrogenase [Nitrobacter hamburgensis X14]
    MPDTSFDIIIIGSGPGGYVTAIRAAQLGFKTAIIEKQYLGGICLNWGCIPTKALLRSAEIYHYMQHAKDYGLSAEKVSYD
    PKAVVQRSRGVSKRLNEGVGFLMKKNKVTVIWGEASIDAPGKVTVKKSDPRLITEPPKGALGEGSYQASHIIVATGARPR
    VLPGLEQDGRLVWTYFEAMVAPKIPKSLLVVGSGAIGIEFASFFRTMGAEVTVVEVLPQVLPVEDAEIAALARKQFEKQG
    IKIMTSTKVTKLDKKADSVVATIDVGDGKPVAAEFERVISAVGVVGNIENLGLEKLGVKTDRGCIVIDGYGRTNVPGIYA
    IGDVAGPPMLAHKAEHEGVICIEAIKGLHPHPMDKMLIPGCTYCHPQIASVGLTEAKAKEAGRDIRVGRFPFAGNGKAIA
    LGEDQGLVKVIFDKTTGQLLGAHMVGAEVTELIQGYVVAMNLETTEQELMHTIFPHPTLSEMMKEAVLDAYGRVLNM

    >gi|92117301|ref|YP_577030.1| HesB/YadR/YfhF [Nitrobacter hamburgensis X14]
    MTETNITVSERAARRIGEILKSEGDGAMLRISVEGGGCSGFQYKFDIERAKAEDDLVIARDTAVVLVDPASVPFLSGSEV
    DFVDDLIGASFRVVNPNATASCGCGTSFSI

    >gi|92117693|ref|YP_577422.1| peroxidase [Nitrobacter hamburgensis X14]
    MTLSIGTPAPDFEAESTEGHISFHKWLGDGWALFFSHPKDFTPVCTTELGAVARLKPEFDKRGVKLIGISVDPTDQHHLW
    SKDIEETQGVAPNYPLIADVDFNVAKLYGMLPASTSGDVNKRTPADNQTVRNIFVIGPDKQIKLVLIYPMSTGRNWQEVL
    RIIDSLQLTAKHGVSTPSDWKQGEDVFFSAAVPEEEARKKFPKGWKSPKPYFRIVEQPK

    >gi|92117709|ref|YP_577438.1| DSBA oxidoreductase [Nitrobacter hamburgensis X14]
    MPSHRFLAPALFALALGAAPVAASAQSFSDSQRGEIEQIVKNYLLAHPEILEDVSAELSKRQAATEALKHEAAVTKNADA
    IFNSPRGVTLGNKNGDVSFVEFFDYN
    CGYCKRAMADMLELLKSDPKLKVVLKEFPVLGPGSVEAAQVAVAVRMQDPGSKK
    YLDFHQRLLGARGQADKTHALAAAKEAGLDMARIEKDMSSPEVRATLEENFKLAESMGMNGTPSYVIGKQVVVGAVGLET
    LKEKISTARCGKASC

    >gi|92117767|ref|YP_577496.1| arsenate reductase [Nitrobacter hamburgensis X14]
    MTVTIYHNPSCGTSRNTLAMIRQSGEEPVIVEYLKHPPDRVRLRALADAMGIPIRALLREKGTPYAELDLGNPKWTDDQL
    LDFMLAHPILVQRPIVETPKGTRICRPSETVLELLDRPAASFTKEDGEVVRR

    >gi|92117846|ref|YP_577575.1| HesB/YadR/YfhF [Nitrobacter hamburgensis X14]
    MTEMTPNTPAAKPKPRPRPQVMRLTDAAAARVKELAARADSEIVGLRVGIKKGGCAGQSYTVEYAHDIKSTDEVVEDKGV
    KVLVDPKAVLYLLGTEMDYKAEKMQAQFIFNNPNQVSACGCGESVQLTPAKIDG

    >gi|92117857|ref|YP_577586.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nitrobacter hamburgensis X14]
    MSKKIRKNSSKPDAPEAARTATAGRAKSARNADPSSSLAASEKSKSGSAKSRPESQGTDLAEGSRAPSFNLPREDGTRVS
    LADFAGRRLVIFFYPRAGTPG
    CTREAMDFTRLAKEFAACGTTVLGVSADPVKTQDSFRTKHKLSIPLISDEKHDMLEAYG
    AWGEKSMYGRVFLGILRSTVLVNADGRIARIWRRVKVDGHAEEVLAAARDL

    >gi|92118204|ref|YP_577933.1| OsmC-like protein [Nitrobacter hamburgensis X14]
    MPNERFQFSGSDGSELAATLDLPDSEPVAYALFAHCFTCGKDVLAARRIAAGLTARGIAVLRFDFTGLGASEGEFANSTF
    SSNIADLVLAANHLRQTRKAPSLLIGHSLGGAAILAAAAQIPEAKAVATIAAPSDPAHVTHLFADRIADIRAQGTVEVSL
    AGRPFHIKREFLDDIAEHNLMGQVAELRKALLILHSPTDDTVGIDNATRIFIAAKHPKSFISLSGADHLLSQKRDTDYVA
    EVIASWAQRYLEPAPIGPTEDTGSRDVVVQETRRSKFQQTVTVGPHRLTADEPISAGGDDTGPGPYDFLLAALGA
    CTSMT
    MRMYAERKALPLDRVTVTLRHRKVHAEDCAECETKTGMLDQIEREIAMEGALDPEQHRKLMEIADKCPVHRTLTSEIRIA
    TRAVNR

    >gi|92118206|ref|YP_577935.1| protein of unknown function DUF395, YeeE/YedE [Nitrobacter hamburgensis X14]
    MSPDPHLTVYAGFLVGLVFGVVGLLSGFCLMSSLRGYWGQGDGRLVRTYALAIGVAVAATQLLAGAGLVDPGKSIYLQPS
    FSAPLMFAGGIIFGYGMVLSNG
    CGSRALILLGRGNLRSLVVVIVLGIAAQMTLKGLIAPARIAVLQASQATPNVTSLPAL
    AGTLGLSASLARALAALAVSGVLIAFAFSHAAFRRSWGQIAAGLIVGLLVAAGWYATGYLGADDFNPVPVTSITFVAPVA
    DTVQYMMLSTGLTMNFGVALVPGVVLGSLVTALVTRRFHLEAYHSPRHMLRSVTGAAFMGSGGAMAYGCSVGQGLTGLST
    LALASFVAITGIVVGAAVGLRGPLRVQALTSPQDSASAAL

    >gi|92118379|ref|YP_578108.1| thioredoxin reductase [Nitrobacter hamburgensis X14]
    MPAPAHAKVVIIGSGPAGYTAAIYAARAMLEPVLIQGIQPGGQLTITTDVENYPGFADVIQGPWLMEQMEKQATHVGTRI
    VTDTVNSLDVSQRPFRLTCDSGDVYLAETVILATGAQARWLGLPSEDSFKGFGVSA
    CATCDGFFYRGKNVIVVGGGNTAV
    EEALFLTNFATQVTLVHRRDHFRAERILQDRAFKHPKIKVVWDSALDEICGTEDPPKVTHVRLKNVKTGALTEVAADGVF
    IAIGHAPATELVAGKVKLKSSGYIEVAPNSTATSVPGLFAAGDVADEVYRQAVTAAGLGCMAALEAERFLAAHASDRAAA
    E

    >gi|92118414|ref|YP_578143.1| 3-mercaptopyruvate sulfurtransferase [Nitrobacter hamburgensis X14]
    MTSTADDPLVSTEWLAAHLGDAGVKVVDASFKMPGVLPLPVDDFLAAHIPGAVFFDVDAVSDRASPLPHMYPDATQFARD
    VGALGISSGDTVVVYDSGGWVAAPRAWWMFLSFGHGDVRVLDGGLKKWRAERRPVETGKAAPKPGKFTAVFDPAYVRSKA
    QLASNLSSHREQLVDARAVNRFEGGVAEPRPGLRSGHIPGSRNLPYNELFDAASGVMKPLDELRAAFTGAGLDLAKPLVT
    S
    CGSGVSAAVLTLALYRLGVRGSALYDGSWSEWGLQDGPPIATGPA

    >gi|92118415|ref|YP_578144.1| rhodanese-like protein [Nitrobacter hamburgensis X14]
    MTQTITRGIKALLQEANREIETMSVADVKAAVARGEAILVDIRDPRELEREGKIPGSFSCTRGMLEFWIDPESPYAKPVF
    QENKLFIFH
    CASGSRSALAAKTAQDMGLKPVAHLGGGFKAWRDAGEAVENVEPKAKS

    >gi|92118435|ref|YP_578164.1| methionine sulfoxide reductase A [Nitrobacter hamburgensis X14]
    MTVSTERAVLAGGCFWGMQALLRRHPGVISTRVGYTGGELPNATYRNHGDHAEAIEVSFDPQAISYRQLLEFFFQIHDPS
    TQDSQGYDQGASYRSAIFYASDEQKRIAEETIADVDASGLWPGWVVTELEPAGPFWEAEPEHQDYLEHHPNGYTCHFIRP
    QWKLPPRQEAGQAKASGAR

    >gi|92118454|ref|YP_578183.1| hypothetical protein Nham_2958 [Nitrobacter hamburgensis X14]
    MPPSAEFARSTSTNEAAPIRFDNTYARLPEAFYQRVEPATAAAPRLLRVNDALARQLRIDPQFLESPEGVAVLSGNVIAP
    GSEPIAQAYAGHQFGDFVPQLGDGRAILLGEVVDVAGKRYDLQLKGSGRTRFSRGGDGRAALGPVIREYIVSEAMAALGI
    PTTRSLAAVLTGENVMRERVLPGGVLTRVASSHLRVGTFQYFAARGDIENLRVLADYAIERHYPEARSAEDPYRAFYDAV
    VAALARLAARWMLVGFIHGVLNTDNTAIGGETIDYGPCAFMDAYHPDKVFSSIDQFGRYAFANQPAVIRWNLTRFAETLL
    PLMADGTDKAIEAANASIARFKDQYQDAYIRGFRQKLGLALEMEGDLELAADLLARMAENQADFTLTFRALCEAAADPKG
    NAGVRALFANPSAFDEWAARWRERLSLEERSAEARRTAMLAASPVFIPRNHRIEAAIQDAEAGHFDKFHELVEVLAHPYD
    DQPQFADYGKPPAPGEEVQQTF
    CGT

    >gi|92118695|ref|YP_578424.1| twin-arginine translocation pathway signal [Nitrobacter hamburgensis X14]
    MIITRRAFNAALSLSGLAAFATLSPWRLIGEAMAQSATAAEVAKPVSLPDMALGPKDAAVTITEYASMTCPHCARFAEDV
    FPKIKAAYIDTNKIRYVFREFPLDLKAAAGSMLARCIAKDDAGKYFAIINALFKSQDEWAGPKTTESLKLIGKQAGLSGP
    EVETCLKDQALLDKIAADQKYANEVLKVNSTPTFFINGEMVKGEVSFEDLKKKIDPLLKS

    >gi|92118732|ref|YP_578461.1| glutathione peroxidase [Nitrobacter hamburgensis X14]
    MSGVFDFSANTLAGEPCALKLFEGQVLLIVNTASACGFTPQYKDLEELYRAMKPRGFSVLGFPCNQFGKQEPGSPADIQQ
    FCESKYDVTFPMFAKIEVNGDNAHPLYKYLKREKSGLLGASIKWNFTKFLVDRQGNVVARHAPTTKPKTLTQEIEALL

    >gi|92118742|ref|YP_578471.1| alkylhydroperoxidase AhpD core [Nitrobacter hamburgensis X14]
    MKARLNPYQAAPQTMKALQALETQLQASGLEKPLIELVKTRASQINGCAFCIDMHTQDARKQGETEQRLYLLNAWRESPL
    YTDRERAALAWTEAVTLVSETHVPDDVYDDVRRHFSEAETVNLTMLVAAINAWNRIAISFRSIHPVKAAHAA

    >gi|92118895|ref|YP_578624.1| heavy metal translocating P-type ATPase [Nitrobacter hamburgensis X14]
    MSTAGQAESKNGNDCGCAAEAQPASSARASSGSNCCGGEAATAHAHGAHAHHHEHHHGHAADTNDGKVLDPVCGMTVDPQ
    TSKHRFDHHGTIYHFCSAGCRTKFAAAPQSYLDKPKTSKFKTPPPADVPEGTIYTCPMHPEVRQVGPGP
    CPICGMALEPE
    LVSLDDKPNPELADMSRRFWIGLILAVPVIALDMGGHIVGTHGWIGQTLSNWIQLAFATPVVIWAGWPFFVRGWQSLMTR
    NLNMFTLIAMGTGVAYIYSLAATFVPAMFPPAFRGHDGAVAVYFEAAAVITILVLLGQVLELHAREATSGAIKALLDLAP
    KTARRVDLSGADHDVALDDVAVGDRLRVRPGEKVPVDGVIAEGRSSLDESMVTGESMPVSKEAGASVIAGTINRSGSFVM
    QAEKVGRDTLLSRIVQMVAQAQRSRAPIQRLADQVAGWFVPAVIAAAVVAFAVWAFVGPEPRLAFGLVAAVSVLIIACPC
    ALGLATPMSIMVGVGRGAQAGVLIRNAEALERMEKVDTLVVDKTGTLTEGRPRLVAIEAAEGFQKDDLLRLAASVERSSE
    HPLADAIVAAARQRDLPLSAVQEFDAPAGKGVTGKVEGRAVLIGSALFLESRGVAAQAMQDRAEQLRAGGATVINVAVDG
    RLAGLLAIADPVKPSTPAALKALAGDGIKVIMLTGDNRTTANAVAKQLGIADVEADVLPEQKSAVVARLQNEGHVVAMAG
    DGINDAPALAFADVGIAMGTGTDIAMESAGVTLLRGDLMGIVRARRLSEATMRNIRQNLFFAFIYNAAGIPIAAGVLYPI
    FGLLLSPIVAAAAMALSSVSVVGNALRLRAARL

    >gi|92118938|ref|YP_578667.1| thioredoxin-like protein [Nitrobacter hamburgensis X14]
    MTETTPSPSRAESRLPIGPLVAVAVVAVVTALLLGAGHLKSARYGANASVPCGPAVELSKKLAHRAIGEVASLTMASKPR
    QMPDLAFMDGDGQAKKLSDWKGKTVLLNLWATW
    CVPCRKEMPALDKLESKLGSDKFAVIAVNIDTRDADKPKAFLKDANL
    TRLGNFHDAKAEVFQDLKSVGLALGMPTSVLIDGHGCEIGNMAGPAEWDSPDAIDLIQASLAP

    >gi|92118954|ref|YP_578683.1| DSBA oxidoreductase [Nitrobacter hamburgensis X14]
    MAGLGRAPALADVPDEVLTEARVLRDPEIPPAGNEHGDVTIVEYFDYNCPYCRKLAPELAQVVHDDGKVRLIFKDWPILG
    PVSVYASRLALATKYQGKFIAAHEALMSTSSRLTEPRIRDLLAGATIDVDRALKDMAANAGTIDTILKRNNDQAAAFGFN
    GTPAFIIGKFRVPGPLTMAQFDQAIADARKAAAAKKK

    >gi|92119182|ref|YP_578911.1| heavy metal translocating P-type ATPase [Nitrobacter hamburgensis X14]
    MAAAVPLKLRVEGMDCGACAVKIENAMRRLPGVSDIDVNYGLQSLSLVVDEDRTSRHAIETRIRALGYAPVDQSGPIASA
    LRDNNCDATESAWWSSPKGRLVIGSAALMTLAFAVSHVEPGWSNWAYIAATLVGLIPIGRRALAGAVSGTPFSIETLMSI
    AAIGAVAIGAAEEAAVVVFLFAVGELLEGIAAGRARAGIEALIGLVPRTALRQNGSNVETVPVEYLRVGDTVIVRPGDRV
    PSDGTVIEGLSEVNEAPVTGESVPVSKEPGSTIYAGSINANGELHVEITRTAADNTIARIIHMVEEAQGSKAPTARFIDR
    FSRWYTPVAMIMSALVVFVPPLLVGADWFTWIYRGLAVLLIACPCALVISTPAAIAAGLASGARRGLLVKGGAALETLGK
    VKTVAFDKTGTLTSGHPQITDIVVIEGTETEMLAKAAAVERGSSHPLGVAIVSEAERRGLDIPKAFGGGIATPGKAVTAR
    LKSGFVSVGSPRHAAEQGDISDEIKKQVGALERQGKTVVVVSEGKPLLGLIALRDEPRPDAAGGLAKLRALGVRPIMLTG
    DNARTAAAIGGALGLEARAELLPDAKLAAIAVYKGEGPIAMVGDGINDAPALAASSVGIAMGGGTDVALETADVVLLKNR
    VAGVAELIALSRATLSNIWQNIAIAIGLKSVFLVTTLFGATPLWMAILADTGATVLVTANALRLLRLKVET

    >gi|92119187|ref|YP_578916.1| alkyl hydroperoxide reductase/thiol specific antioxidant/Mal allergen [Nitrobacter hamburgensis X14]
    MTIKVGDRLPDATFRIMTDDGVQVKSTGDIFKGRKVALFAVPGAYTGTCHKQHLPSIFLSARAIKDKGVDEIAIVSVNDV
    FVMNTWKRDTDQRNEATFLADGNADFARAIGMEFDASEKGLGIRSKRYSMLVEDGVVKTLNLEPNPGKVEVSGGDTLLGQ
    L

    >gi|92118220|ref|YP_577949.1| electron transport protein SCO1/SenC [Nitrobacter hamburgensis X14]
    MMTRGFLPLLAIVAATGIAALAWETDGFRVVTSAGARQLSIERTPLLLPDVRLVDQDGHAFALSSYKGRPVLVDFIYTRC
    PTLCGVLGDDFHGVLQLMRRAGAGAPLDLLSISFDPQNDDREALQLYGDRYGAKAPRWRIAAPADERGLAALKQSFGVVV
    IPDGMGGFIHNSAVYLVDARGRLVRILDPDSPPQLLADALRESLP