Neorickettsia sennetsu Miyayama uid57965

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|88608714|ref|YP_506098.1| glutaredoxin-related protein [Neorickettsia sennetsu str. Miyayama]
    MKDIFAKIEGIIRRHDVVLFMKGTSGLPMCGFSGAVVNILKALDVTFYGVNVLEDPELREGIKKFADWPTIPQLYVKGEF
    IGGCDIVREMYENRELQTLFEDSLAG

    >gi|88608181|ref|YP_506121.1| thioredoxin [Neorickettsia sennetsu str. Miyayama]
    MDLITELKPTDRIALEDDQLSIVEFYLPTCKACNNFASTYEELAQENQEVKFYKMNVTSSKGESPSQTWKVRAVPTVAVF
    AGSVSPDNELARILGNKPKETIQRLLEEYKPS

    >gi|88607981|ref|YP_506148.1| rhodanese domain-containing protein [Neorickettsia sennetsu str. Miyayama]
    MGLKRFYARLSRAGGFFVELFMEKFTLVTFYHFVQLENYEDMRDELLSCCIEKGLKGTVLLALEGINGSVAGHDGEIRDF
    LDFVRRDERLRGLEWKESYTNFQPFQEMKVRLKKEIVALGCAELENMEICETGEYVEPEDWSSLIAREDVKTIDTRNLYE
    TKLGRFKYSIDPETINFRDFQEWVRKWIEKDNVSMEQKIAMY
    CTGGVRCEKSTAYMKRIGFKNVYQLKGGIINYFLKTKN
    KDGAWVGDCFVFDDRVAVNVDLEPIQLKCLECSCVVNTDDLKNIPRGRVLCSGCGQNTTRFS

    >gi|88608116|ref|YP_506191.1| iron-sulfur cluster assembly accessory protein [Neorickettsia sennetsu str. Miyayama]
    MNLNGPPIAVSALAFQKFVELIDERKRKGKPTLGIRIKLLSKGCGGNEYGMEYVEEAEQCDEMLELAQPPMGKVSLFVDP
    KTMLRIIGTKIDYEETKFKSGFVFKNPREKGRCGCGKSFYY

    >gi|88608660|ref|YP_506201.1| glutaredoxin 3 [Neorickettsia sennetsu str. Miyayama]
    MNHKVVIYVKEFCPYCSRAKELLDRKGVLYTVVDITNDPDLAVVMMERSGGRKTVPQVFINDVCVGGFDDLNSLNESGKL
    NELLFLNNQ

    >gi|88608597|ref|YP_506348.1| dihydrolipoamide dehydrogenase [Neorickettsia sennetsu str. Miyayama]
    MYDVIVVGGGPAGYPAAIRASRSGLKVALVEKNKLGGVCLNCGCIPTKALLHIAEKYHFVKTGAAELGINVSNVFLTFSS
    AIAYAQEKIKKLAAGVSYLMKKNKVELFYSSGRILPGKQVKLEDLGKTISAKNIILATGSTPKEITGLEYDHELIWNYND
    AMTATKMPKSLLVVGAGAIGVEFACIYNVFGSKVTVIEMQNQILPAEDTEISNLAEAAFKESGITIRKGTTIQSLKKDKD
    KVLVTLSDGTNLEVERILVAGGVEASSQNLGLEQIPTIRMNKGFVSVDKYCETGEPGVYAIGDLRGFPCVAHKAIYDAYV
    CTAKIAGKEPVPLEMDSIPSCIYSFPSIASVGLTEEAAIRMGHKVKIGRAKAEGNGKSVVLGKDKGLVKTVFDAKTGELL
    GAHIIGYEATEILNGYIIAKASEATVESLKAVVFPHPTISEMMYEAVLAADNEEVHS

    >gi|88608277|ref|YP_506440.1| thioredoxin-disulfide reductase [Neorickettsia sennetsu str. Miyayama]
    MCDALESDVIIIGSGPAGCTAGIYAARASLSVVIVSGNQSGGQLTTTTEVENYPGFALPVQGPWLMEQMQQQAVNVGCRL
    VNDHILQIEAPYSSPFVLRGEGGNKYRARSIVVATGAQAKWLGLESEKKYQGYGVSG
    CATCDGFFFRDQDVIVIGGGNTA
    VEEALYLTRHAKKVYLLHRRERLRAETVLQERLFANAKVELIWNSVLDEILGRDSPPEVTGVRVRSLMDGTFREILVSGV
    FVAIGHAPNTALFSGILEMDSAGYIKTSSSDTSTSVSGIFACGDVQDPVYRQAVTAAGTGCMAALDAIRFLDCI

    >gi|88608779|ref|YP_506441.1| anti-oxidant AhpCTSA family protein [Neorickettsia sennetsu str. Miyayama]
    MSTLVGKKAFDFTAKAVLKNGSFCDDFNLQRELSGKYGVLFFYPLDFTFVCPTEIIAFSNRIPAFIERNAVVVGVSVDSH
    FSHFAWRSLPVKDGGIGSIGYTLVSDITKSISRDYQVLLDDAVALRGTFIIDPNFVIRVAHVNDLNVGRNVDEVLRTLDA
    LKYSDENGEVCPAGWSKGKEAIKATHESISDYLASNRDEL

    >gi|88608170|ref|YP_506549.1| dihydrolipoamide dehydrogenase [Neorickettsia sennetsu str. Miyayama]
    MCHFFVRMSEKEFDVVVIGGGPAGYVCSIKAAQLGMKVACVEKRPSLGGTCLNEGCIPSKALLHSSYAYYSAKKCFDVLG
    VECSDVKLNLTKMMGNKSRIVMELSQGIEFLFKKNKVTRFTGTGSILANGDTKKKSVIIDKTETIHTKYVVLATGSEAAE
    LPFAKCDEKSILSSRGALELDAVPKSMIIIGGGAIGLEMASIWSRLGTEVTLMEYADRIAAASDGEVSDYLLKSLTKQGI
    KFHLSSRITEIKKGKLLSATFEKDEKIGSISAEKILVAVGRRPYSANIGVELERNPSGFIKVDKNFQTSVPGVYAIGDTI
    PGVMLAHKAEEEGVAVAEILAGRTGHIGWIPSVIYTHPEVASVGKTEEELKVIGIKYKASKFPFAANSRAKTTNDTGGFV
    KMLVDEHDTVLGVHIVGPSASSLIAEAVLAMEYGASAEDIARTCHSHPDLNEAMKEAALGAFFKPIHF

    >gi|88608278|ref|YP_506599.1| bacterioferritin comigratory protein [Neorickettsia sennetsu str. Miyayama]
    MSTLEVDDLAPSFYLPSSMGGMISLQDFLGKAGLVIYFYPKDDTPGCTQEAKDFKEHIAEFKELNVVVIGISKDNLRAHK
    NFSTRYDLPFHLLSDESTETIQKYGAWVEKSMFGKKYYGIERSTFVVDLNGKVRKLWRRVRVSGHVKEVLDFCRSNQFRN
    AS

    >gi|88608145|ref|YP_506652.1| molybdopterin biosynthesis protein MoeB [Neorickettsia sennetsu str. Miyayama]
    MNRRYLRHFGLFGKEGQYTLLDAKVAVIGSGGLGCSVLYNFAAAGLGEIVIVDFDRVSESDLNRQFLFENSSVQQLKVYA
    AKRRLNAFNPDCKIFCYPMRIQDCPEVIEGCEVVVDCTDNFKTRFYLNELCFFQKKALISAGVTGYSGYVIVLKPFISED
    SPCYRCFCPGEPEACFKGS
    CEDGGVIGAAVNTIGSIQAMKVIQEILHINPEKAGKLIFCDILNNRFRSAVIMRDPYCSVC
    GQRCV

    >gi|88608472|ref|YP_506654.1| pyridine nucleotide-disulphide oxidoreductase family protein [Neorickettsia sennetsu str. Miyayama]
    MNTDVIIIGAGPVGIFTAFQAGMLGMRAHVIDSLLSIGGQCTALYPEKFIYDIPGYKQITAAALISNLAEQAERFNPTYH
    TDQFATHMDRLDTSFVVKTSKEIEITAKAVIIAAGAGAFDYNRIPIESSHVYEGKSLFYSVKDPSIFTSKVVVIAGGGDS
    AADWGLILSKLARKVYLIHRRSKFRCSDSTFKDLKSLEETKKLKILTPYQITGLRGSGGQISHIELGGLTGESVTLEADY
    LLAFFGLKPSLRHLEEWGIEITHNCINVDPLTCSTNIKGVYAVGDVAHYDSKLKLILSGFSEAATACHHIRETIIGGDVY
    NFRYSTNMNEVFR

    >gi|88608840|ref|YP_506750.1| hypothetical protein NSE_0884 [Neorickettsia sennetsu str. Miyayama]
    MVRMNTPEASLGFKAPPFSIEFGGSMYSLSSVAGPSGTLVMFICNHCPYVKQIVRQLSKDVKLMQERGIGVVAVMPNDVS
    SYPEDSPEKMADFAQEYGFSFPYIYDADQRIAASYGAVCTPDFFGFDRNLELQYRGQFIDLASGTHDLLDAMLEIAGGRK
    VSRKQKPSIGCSIKWK

    >gi|88608595|ref|YP_506760.1| thioredoxin 1 [Neorickettsia sennetsu str. Miyayama]
    MDELKDFSTQVSGVSGLVLLDFWADWCAPCKQLIPILEAFAESAENVKVYKVNIDGPGQDLAVSNGVRAVPTLILFKDGK
    IVDRKVGSLSLSQLKEWVATFS

    >gi|88608124|ref|YP_506766.1| hypothetical protein NSE_0900 [Neorickettsia sennetsu str. Miyayama]
    MCMSYKLFLCGLVALISFSLAFSAPSSLHSDALKFNPRTVKLSENLLFPADLPIGGIDAPITIVDYSSFSCTHCKAAFER
    LILPTYEKYVRTGKVMLIMRDFPLDKLSFDASVFLGCYRKTIMPDDERVIKLITKLFDIGNGSKNKEDAGKAFDGIVSDS
    NLQGNTKEKFLSCVEDLGVKDDVLYSKLFGIKKIGIDGTPMIFINGERYTGPFKFSSFEKKIEKILNNSR

    >gi|88608383|ref|YP_506767.1| disulfide oxidoreductase [Neorickettsia sennetsu str. Miyayama]
    MRTFLLVLALVAIAGLPFVSNWYYGHVKDSYAISQTEKVVEEYIKKNPEKILESVNQYRLAQFEEQQKQKEREMSELVVQ
    HKNEVFDTRYPSFVAKNGKAALVEFFDAS
    CGYCKLASQILLKLKRDYPNVTYTLRSLPILGQSSLVAAKYDTGVFLFMKE
    KGIQDSKYSDFHSKLMAHEGVYTPEVVKEILSGISLDPQEVLKFIEENEGEISGMVEATVQLAQKLRLEGTPVFIVGDKI
    VQGVNEAGLREMLEKVS