Neorickettsia risticii Illinois uid58889

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|254796590|ref|YP_003081426.1| putative glutaredoxin-like protein [Neorickettsia risticii str. Illinois]
    MREIFAKIEGIVGRHDVVLFMKGTSEMPMCGFSGAVVNILKALGVTFYGVNVLEDPELREGIKKFADWPTIPQLYVKGEF
    IGGCDIVREMYESGELQTLFENSLAG

    >gi|254796612|ref|YP_003081448.1| thioredoxin [Neorickettsia risticii str. Illinois]
    MDLITELNATDRIALEDGQLGIVEFYLPTCKACNNFASTYEELAQENQEMKFYKMNVTSNNGESPSQMWKVRAVPTVAVF
    TENVSPDNELARILGNKPKEVVQTLLEKYKPS

    >gi|254796638|ref|YP_003081474.1| rhodanese domain protein [Neorickettsia risticii str. Illinois]
    MVSCSVLVGFFELFMEKFTLVTFYHLVQLENYEDMRDELLSYCIGKGLKGTVLLAMEGINGSVAGHDGEVRDFLDFVRRD
    DRLCGLEWKESYTSFQPFQEMKVRLRKEVVALGCAELENMGMCETGEYVEPEDWTSLIAREDVKTIDIRNLYETKLGRFK
    YSIDPETINFRDFQDWVRRWIEKDNISTDQKIAMY
    CTGGIRSEKSTAYMKMIGFKNVYQLRGGIIHYLLKTKNTDGAWVG
    DCFVFDDRVAVNVDLEPVQLKCLECSCVVNTDDLKNIPRGRVLCSGCGQNTQFS

    >gi|254796681|ref|YP_003081517.1| iron-sulfur cluster assembly accessory protein [Neorickettsia risticii str. Illinois]
    MNLNGPPIAVSALAFQKFVELIDERKRKGKPTLGIRIKLLSKGCGGNEYGMEYVEEAGQHDEMVELEQGPMGKVSLFVDP
    KTMLRIIGTKIDYEETKFKSGFVFKNPREKGRCGCGKSFYY

    >gi|254796821|ref|YP_003081658.1| dihydrolipoyl dehydrogenase [Neorickettsia risticii str. Illinois]
    MYDVIVVGGGPAGYPAAIRASRSGLKVALVEKNKLGGVCLNYGCIPTKALLHVAEKYHFVKTGAAELGINVSGVSLSFGS
    AIAYAQEKIKKLAAGVSYLMKKNKVEIFYSSGRILPGKKVELGDLGKTISAKNIILATGSTPREIAGLEYDHELIWNYND
    AMTASKMPESLLVVGAGAIGVEFACIYNAFGSKVTIIEMQSQVLPAEDTEISNLAEAAFKESGITIQKGTTIQSLKKDKD
    KVLVALSDGTNLVVERILVAAGVEANSQNLGLEQIPTIRMNKGFVSVDEYCETGESGVYAIGDLRGFPCVAHKAIYDAYV
    CTAKIAGKEPIPLEMNSIPSCIYSFPSIASIGLTEEAAVRMGHKVKIGRAKAEGNGKSVVLGKDKGLVKTVFDSKTGELL
    GAHIIGYEATEILNGYIIAKASEATIESLKAVVFPHPTVSEMMYEAVLAADNEEVHS

    >gi|254796912|ref|YP_003081749.1| thioredoxin-disulfide reductase [Neorickettsia risticii str. Illinois]
    MRDALESDVLIIGSGPAGCTAGIYAARASLSVIIVSGNQSGGQLSTTTEVENYPGFALPVQGPWLMEQMQQQAVNVGCRF
    VNDHISQVEAPYSSPFILRGEGGNKYRARSIVVATGAQAKWLGLESEKKYQGYGVSG
    CATCDGFFFRDQDVIVIGGGNTA
    VEEALYLTRHAKKVYLLHRRDRLRAEAVLQERLFANAKVELIWNSVLDEVLGRDSPPEVTGVRVRSLIDGTFKEILVSGV
    FVAIGHTPNTALFSGILEMDSAGYIKTAGSDTSTSVSGIFACGDVQDPVYRQAVTAAGTGCMAALDAMKFLDCI

    >gi|254796913|ref|YP_003081750.1| antioxidant, AhpC/Tsa family [Neorickettsia risticii str. Illinois]
    MVYNALLGGGLIGMSTLVGKKAFDFTAKAVLKNGSFCDDFNLQRELSGKYGVLFFYPLDFTFVCPTEIIAFSNRIPAFIE
    RNAVVVGVSVDSHFSHFAWRSLPVKDGGIGSIGYTLVSDITKSISRDYQVLLDDAVALRGTFIIDPNFVIRVAHVNDLNV
    GRNVDEVLRTLDALKYSDENGEVCPAGWSKGKEAIKATHESVSDYLASNRDEL

    >gi|254797024|ref|YP_003081861.1| dihydrolipoyl dehydrogenase [Neorickettsia risticii str. Illinois]
    MSEKEFDVVVIGGGPAGYVCSIKAAQLGMRVACVEKRTSLGGTCLNEGCIPSKALLHSSYAYYSAKKHFDVLGVECSDVK
    LNLTKMMENKSRIVTELSQGIEFLFKKNKVTRFTGTGSIIDNGDTEKKSIIIDKTEIIHTKYVVLATGSEAAELPFIRCD
    EKSILSSRGALELDSVPKSMIIVGGGAIGLEMASIWSRLGTEVTLIEYANRIAATSDGEVSNYLLKSLTKQDIKFYLSSR
    ITEIKKEKFLSATFEKDEKIESISAEKILVAVGRRPYSANIGVELEKNPSGFIKVDKNFQTSIPGIYAIGDVIPGVMLAH
    KAEEEGVAVAEILAGRTGHVGWIPSVIYTHPEVASVGKTEEELKAIGVKYKASKFPFAANSRAKTTNDTEGFVKMLVDEH
    DTILGVHIVGASASSLIAEAVLAMEYGASAEDIARTCHSHPDLNEAMKEAALGAFFKPIHS

    >gi|254797072|ref|YP_003081910.1| bacterioferritin comigratory protein [Neorickettsia risticii str. Illinois]
    MNTLEVDDLAPSFCLPSSMGGMVSLQDFLGKAGLVVYFYPKDDTPGCTQEAKDFKEHIAEFKELNVVVIGISKDNLRAHK
    NFSTRYALPFHLLSDESTETIQKYGAWVEKSMFGKKYYGVERSTFVVDLNGKVRKLWRKVQVSGHVKEVLDFCKSDQFRH
    AS

    >gi|254797117|ref|YP_003081955.1| molybdopterin biosynthesis protein MoeB [Neorickettsia risticii str. Illinois]
    MFECCMKSVHYLNKCSVPRLFLASAGEAIDFLVFAVREWCTLIGVCSVNRRYLRHFGLFGKEGQYALLDAKVAVIGSGGL
    GCSVLYNLAAAGLGEIVIVDFDRVSESDLNRQFLFENSSVQQLKVYAAKRRLNAFNPDCKIFCYPMRIQDCSEVIEGCEV
    VLDCTDDFKTRFYLNELCFLKRKALISAGVTGYSGYVIVLKPFVSDDSPCYRCFCPGEPEACFKGS
    CEDGGVIGAAVSTI
    GSIQAMKVIQEILHINPEKAGKLIFCDILNNRFRSAIIMRDPYCNVCGQRCS

    >gi|254797118|ref|YP_003081956.1| thioredoxin reductase [Neorickettsia risticii str. Illinois]
    MNTDVIIIGAGPVGIFTAFQAGMLGMRVHVVDSLPSIGGQCTALYPEKFIYDIPGYKQITAAALISNLADQAERFNPTYH
    TGQFATHMTRLDTSFAVKTSKEIEITAKAVIIAAGAGAFDYNRIPIESSHVYEGKSLFYSVKDPSIFANKAVVIAGGGDS
    AADWCLILSNIARKVYLIHRRSKFRCSDSTFRDLKSLEETKKLKILTPYQITGLRGSRSQISHVELGGLTGESVTLEADY
    LLAFFGLKPSLRHLEDWGLDITHHCINVDPLTCSTNIKGVYAVGDVAHYDSKLKLILSGFSEAATACHHIREKIIGEDVY
    NFRYSTNMNEVFK

    >gi|254797214|ref|YP_003082055.1| thiol-disulfide isomerase, thioredoxin family [Neorickettsia risticii str. Illinois]
    MVRMNTPEASLGFKAPPFSIEFSGSVCSLSSIAGSSGTLVMFICNHCPYVKQIVRQLSKDVKLMQERGVGVVAVMPNDVS
    AYPEDSPEKMADFAQEYGFSFPYVYDAEQSIAASYGAVCTPDFFGFDRNLELQYRGQFMDLASGTHDLLDAMLEIADGRK
    VSRKQKPSIGCSIKWK

    >gi|254797223|ref|YP_003082064.1| thioredoxin [Neorickettsia risticii str. Illinois]
    MDELKDFSTQVSGVPGLVLLDFWADWCAPCKQLIPTLEAFAESAENVKVYKVNIDGPGQDLAVSNGVRAVPTLILFKDGK
    IVDRKVGALSLSQLKEWVATFS

    >gi|254797229|ref|YP_003082070.1| hypothetical protein NRI_0867 [Neorickettsia risticii str. Illinois]
    MSYKLFLCGLAALISFSLAFSAPSSLHSDALKFNPRTVRVSENLLFPADLPVGSTDAPITIVDYSSFSCTHCKAAFEKLI
    LPVYEKYVRTGKVMLIMRDFPLDKLSFNASVFLGCYRKTIIPDDEHVIRLITKLFDIGSGAKSKEDAEKMFDGIVSDSNL
    QGSTKEKFLSCMEDLGVKDEVLYSKLFGIKKIGIDGTPMIFINGERYTGPFKFSFFERKIEKILNDRKS

    >gi|254797230|ref|YP_003082071.1| disulfide oxidoreductase [Neorickettsia risticii str. Illinois]
    MLTLRKLIKTILRCWFYSCSTVLKMRTFLLVLALVAIAGFPFVSNWYYGRVRDSYAISQTEKVVEEYIKKNPEKILESVN
    QYRLAQFEEQQKQKEQEMSRLIAQHKSEVFDTRYPSFVAENGKATLVEFFDAS
    CGYCKLASQILLKLKRDYPNVTYTLRS
    LPILGQSSLIAAKYDTGVFLFMKEKDIQDSKYSDFHSKLMSHEGTYTPEVVTGILSEISLDPQEVLKFVEKNEGEISSMV
    EATVQLAQKLRLEGTPVFIVGDKIVQGVSEAGLREILEKAS