Neisseria meningitidis Z2491 uid57819

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|218767274|ref|YP_002341786.1| putative oxidoreductase [Neisseria meningitidis Z2491]
    MPEIKIFHNPRCSKSRAALSLLEERGIAAEVVKYLDTPPDLSELKDIFNKLGLASARGMMRVKDDLYKELGLDNPNLDND
    ALLRAIADHPALLERPIVLANGKAAVGRPLENIEAVL

    >gi|218767275|ref|YP_002341787.1| putative periplasmic thiredoxin [Neisseria meningitidis Z2491]
    MKYLNLAAITLAATFAAHTASADELAGWKDNTPQSLQSLKAPVRIVNLWATWCGPCQKEMPAMSKWYKAQKKGSVDMVGI
    ALDTSDNIGNFLKQTPVSYPIWRYTEANSRNFMKSYGNNVGVLPFTVVEAPKCGYKQTITGEVNEKSLTEAVKLAHSKCR


    >gi|218767302|ref|YP_002341814.1| trifunctional thioredoxin/methionine sulfoxide reductase A/B protein [Neisseria meningitidis Z2491]
    MKHRTFFSLCAKFGCLLALGACSPKIVDAGAATVPHTLSTLKTADNRPASVYLKKDKPTLIKFWASWCPLCLSELGQTEK
    WAQDAKFSSANLITVASPGFLHEKKDGDFQKWYAGLNYPKLPVVTDNGGTIAQSLNISVYPSWALIGKDGDVQRIVKGSI
    NEAQALALIRDPNADLGSLKHSFYKPDTQKKDSKIMNTRTIYLAGG
    CFWGLEAYFQRIDGVVDAVSGYANGNTKNPSYED
    VSYRHTGHAETVKVTYDADKLSLDDILQYFFRVVDPTSLNKQGNDTGTQYRSGVYYTDPAEKAVIAAALKREQQKYQLPL
    VVENEPLKNFYDAEEYHQDYLIKNPNGYCHIDIRKADEPLPGKTKTAPQGKGFDAATYKKPSDAELKRTLTEEQYQVTQN
    SATEYAFSHEYDHLFKPGIYVDVVSGEPLFSSADKYDSGCGWPSFTRPIDAKSVTEHDDFSYNMRRTEVRSHAADSHLGH
    VFPDGPRDKGGLRY
    CINGASLKFIPLEQMDAAGYGALKSKVK

    >gi|218767366|ref|YP_002341878.1| ThiF protein [Neisseria meningitidis Z2491]
    MTTTEHDNDDAFLLRYSRHILLDEIGIEGQQKLSAAHILVVGCGGLGAAALPYLAASGIGTLTIADSDTVELHNLQRQVA
    FDEGDVGKLKTEALADRLRHINHTVDVRTINEKLDGCRLTGLVQAADIVLDCCDNYATRQAVNRACVQAKTPLVSGAAVR
    FEGQLAVYRPDLPDSPCYACLFDGGSASDGI
    CSLFGVFSPLVGIIGSTQAAEALKILLDAGEPSHGRLAVYRALEGGWQY
    FDLPRNPECPVCGAER

    >gi|218767471|ref|YP_002341983.1| putative periplasmic protein [Neisseria meningitidis Z2491]
    MKKILTAAVVALIGILLAIVLIPDSKTAPAFSLSDLHGKTVSNADLQGKVTLINFWFPSCPGCVSEMPKIIKTANDYKNK
    NFQVLAVAQPIDPIESVRQYVKDYGLPFTVMYDADKAVGQAFGTQVYPTSVLIGKKGEILKTYVGEPDFGKLYQEIDTAL
    AQ

    >gi|218767476|ref|YP_002341988.1| putative regulator of pilE expression [Neisseria meningitidis Z2491]
    MMTLYSGITCPFSHRCRFVLYEKGMDFEIKDVDIYNKPEDLAVMNPYNQVPVLVERDLVLHESNIINEYIDERFPHPQLM
    PGDPVMRGRGRLVLYRMEKELFNHVQVLENPAATNKEQAKAREAIGNGLTMLAPSFSKSKYILGEDFSMIDVALAPLLWR
    LGHYDVKLGKSAAPLLKYAERIFQREAFIEALTPAEKAMRK

    >gi|218767538|ref|YP_002342050.1| hypothetical protein NMA0573 [Neisseria meningitidis Z2491]
    MDIVQLGSAELKAWMDEGRMFCLLDVRTDEEAAICSLPDALHIPMNLIPLRQNELPDDVPLVVYCHHGIRSLHTAMYLAD
    AGFENLYNLQGGIDAWAVEVDAEMARY

    >gi|218767572|ref|YP_002342084.1| putative periplasmic thioredoxin [Neisseria meningitidis Z2491]
    MKKKLLSGIKFAVQTALVFLLVSLFLDWIRKPEEPAGAAGRPLTLLSGQRLTLGQFSRDKAVLVYFWGSWCGVCRYQSPI
    IDDLAADGVPVVGVAVRSGSASEVAAYMAKRGLGFPTVNDEDGGLARSWRIVATPAVVLVKNGKMVHYTTGISSYWGLRA
    RIFQADVFG

    >gi|218767624|ref|YP_002342136.1| putative glutaredoxin [Neisseria meningitidis Z2491]
    MQTVTMYTGPFCPYCTMAKRLLHAAGVGHIDEIRVDASPEAFAEMQQLSGQRSVPQIFIGETHVGGFTDLYRLQQEGGLD
    GLLNP

    >gi|218767672|ref|YP_002342184.1| putative thiol:disulphide interchange protein [Neisseria meningitidis Z2491]
    MKTKLIKILTPFTVLPLLACGQTPVSNANAEPAVKAESAGKSVAASLKARLEKTYSAQDLKVLSVSETPVKGIYEVVVSG
    RQIIYTDAEGGYMFVGELINIDTRKNLTEERAADLNKIDFASLPLDKAIKEVRGNGKLKVAVFSDPD
    CPFCKRLEHEFEK
    MTDVTVYSFMMPIAGLHPDAARKAQILWCQPDRAKAWTDWMRKGKFPVGGSICDNPVAETTSLGEQFGFNGTPTLVFPNG
    RSQSGYSPMPQLEEIIRKNQ

    >gi|218767680|ref|YP_002342192.1| iron-sulfur cluster insertion protein ErpA [Neisseria meningitidis Z2491]
    MSDESPIIFTDSCCAKVADLIAEENNPDLKLRVFVNGGGCSGFQYGFTFDEIKNDDDFEIEKNGLVFLVDPMSYQYLVGA
    EIDYTESLQGSQFVIRNPNAETTCGCGSSFSV

    >gi|218767688|ref|YP_002342200.1| Na(+)-translocating NADH-quinone reductase subunit E [Neisseria meningitidis Z2491]
    MEHYLSLFIKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVIFVLGLSVPANQLVYSLLKDGAIVEGVDLTFLKFI
    TFIGVIAALVQILEMFLDKFVPALYNALGIYLPLITVN
    CAIFGAVSFMAQREYGFGESVVYGFGAGLGWMLAIVALAGIT
    EKMKYSDAPKGLKGLGITFIAAGLMAMAFMSFSGIQL

    >gi|218767689|ref|YP_002342201.1| Na(+)-translocating NADH-quinone reductase subunit D [Neisseria meningitidis Z2491]
    MADMKRLKHLMFSPFIDNNPIALQVLGICSALAVTTKLQTAIVMGISVALVTGFSSFFISLVRNYIPNSIRIIVQMAIIA
    SLVTLVDQLLQAFAYELSKQLSVFVGLIITN
    CIVMGRAEAFAMKEPPLESLIDGIGNGAGYGMMLLVVATVRELIGSGKL
    LGYTVFQTVQDGGWYQTNGLFLLAPSAFFIIGFLIWGLRTWKPEQAEE

    >gi|218767873|ref|YP_002342385.1| hypothetical protein NMA0963 [Neisseria meningitidis Z2491]
    MAIAAVRLRAVLNNGNIGSRTMDVKYEFTLPSSSGADFHSAEHLPLVVYFYPKDSTPGCTTEGLDFNARLEQFEALGYTV
    VGISRDGVKAHQNFCAKQGFRFELLSDKDETVCRLFDVIKLKKLYGKESLGIERSTFVLNKDGEIAHEWRKVKVAGHAQE
    VLETLSR

    >gi|218767876|ref|YP_002342388.1| putative thioredoxin [Neisseria meningitidis Z2491]
    MKLTLMFREYCSLCHKMRDALKPFQNEYGFGLEVVDVDENPVLEEKYNELVPVLLAGDEEICHWFLDEDRLKQFLER

    >gi|218767893|ref|YP_002342405.1| hypothetical protein NMA0984 [Neisseria meningitidis Z2491]
    MASIHDQIKEVVTTHRVVLFMKGTKQFPQCGFSSRAVQILNAAGCTDYVTVNVLENPEVRQGIKEYSDWPTIPQLYVNGE
    FVGGSDILMEMYEAGELQELLKA

    >gi|218767903|ref|YP_002342415.1| putative periplasmic protein [Neisseria meningitidis Z2491]
    MNIKHLITAALIASAAFAAQAAPQKPVSAAQTAQHSAVWIDVRSEQEFSEGHLHNAVNIPVDQIVRRIHEAAPDKDTPVN
    LY
    CRSGRRAEAALQELKKAGYTNVANHGGYEDLLKKGMK

    >gi|218768030|ref|YP_002342542.1| putative redoxin [Neisseria meningitidis Z2491]
    MALQDRTGQKVPSVVFRTRVGDTWKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYNELFGAFKENGVDAIYCVSVN
    DTFVMNAWAAEEESDNIYMIPDGNGEFTEGMGMLVGKEDLGFGKRSWRYSMLVNDGVVEKMFIEPEEPGDPFKVSDADTM
    LQFVAPDWKAQESVAIFTKPG
    CQFCAKAKQALQDKGLSYEEIVLGKDATVTSVRAITGKMTAPQVFIGGKYIGGSEDLEA
    YLAKN

    >gi|218768031|ref|YP_002342543.1| dihydrolipoamide dehydrogenase [Neisseria meningitidis Z2491]
    MKKIQADVVVIGGGTAGMGAFRNARLHSDNVYLIENNVFGTTCARVGCMPSKLLIAAAEARHHALHTDPFGVHLDKDSIV
    VNGEEVMQRVKSERDRFVGFVVADVEEWPADKRIMGSAKFIDEHTVQIDEHTQITAKSFVIATGSRPVILPQWQSLGNRL
    IINDDVFSWDTLPKRVAVFGPGVIGLELGQALHRLGVKVEIFGLGGIIGGISDPVVSDEAKAVFGEELKLHLDAKTEAKL
    DADGNVEVHWEQDGEKGVFVAEYMLAAVGRRPNVDNIGLENINIEKDARGVPVADPLTMQTSIPHIFIAGDASNQLPLLH
    EAADQGKIAGDNAGRYPNIGGGLRRSTIGVVFTSPQIGFVGLKYAQVAAQYQADEFVIGEVSFKNQGRSRVMLVNKGHMR
    LYAEKATGRFIGAEIVGPAAEHLAHLLAWAHQMKMTVPQMLDMPFYHPVIEEGLRTALRDADAKLKA

    >gi|218768040|ref|YP_002342552.1| dihydrolipoamide dehydrogenase [Neisseria meningitidis Z2491]
    MSQYDVVVIGAGPGGYVAAIRAAQLGFKTACVDAGVNKAGNAPALGGTCLNVGCIPSKALLQSSEHFHAAQHEFAEHGIT
    VGDVKFDVAKMIERKDAIVTKLTGGVKFLFQKNKVTSLFGTASFAGKNGDAYQIEVDNKGEKTVIEAKHVIVATGSVPRP
    LPQVAIDNVNVLDNEGALNLTEVPAKLGVIGSGVIGLEMGSVWNRVGAEVTILEAAPTFLAAADQQIAKEAFKYFTKEQG
    LSIELGVKIGDIKSEGKGVSVAYETAAGEAKTEVFDKLIVAIGRIPNTKGLNAEAVGLEKDERGFIKVDGECRTNLPNVW
    AIGDVVRGPMLAHKASDEGVAVAERIAGQKPHIDFNNVPFVIYTDPEIAWVGKTEEQLKAEGVEYKKGTSGFGANGRALA
    MGKAKGTVKVLADAKTDRILGVHMIGPVVSELLTEGVTALEFFASSEDIARIIHAHPTLSEVVHEAALAADKRALHG

    >gi|218768084|ref|YP_002342596.1| hypothetical protein NMA1203 [Neisseria meningitidis Z2491]
    MARLTVHTLETAPEAAKARVEAVLQNNGFIPNLIGVLSNAPEALAFYQEVGKLNAANSLTAGEVEVIQIIAARTNQCGFC
    VAGHTKLATLKKLLSEQSVKAARALAAGEFDDAKLGALAAFTQAVMAKKGAVSDEELKAFFDAGYNQQQAVEVVMGVALA
    TLCNYVNNLGQTEINPELQAYA

    >gi|218768241|ref|YP_002342753.1| hypothetical protein NMA1408 [Neisseria meningitidis Z2491]
    MIILHGIPNCDTVKKAKNRLAGYGLEFEFRDFKKQRPSEAEICSWLEQVPLATLLNKRGTSWRKLDAETQQKVLSSTAEA
    VKLMSEMPSLIKRPVLECGGKVYASFSEETYDGIFNRQAPCRQG

    >gi|218768266|ref|YP_002342778.1| putative P-type cation-transporting ATPase [Neisseria meningitidis Z2491]
    MKKTCFHCGLDVPENLHLTVRYENEDRETCCAGCQAVAQSIIDAGLGSYYKQRTADAQKTELPPQEILDQIRLYDLPEVQ
    SDFVETHGGTREAVLMLGGIT
    CAACVWLIEQQLLRTDGIVRIDLNYSTHRCRVVWDDGKIRLSDILLKIRQIGYTAAPYD
    AQKIEAANQKERKQYIVRLAVAGLGMMQTMMFALPTYLYGGDIEPDFLQILHWGGFLMVLPVVFYCAVPFYQGALRDLKN
    RRVGMDTPITVAIIMTFIAGVYSLATNAGQGMYFESIAMLLFFLLGGRFMEHIARRKAGDAAERLVKLIPAFCHHMPDYP
    DTQETCEAAVVKLKAGDIVLVKPGETIPVDGTVLEGSSAVNESMLTGESLPVAKMPSEKVTAGTLNTQSPLIIRTDRTGG
    GTRLSHIVRLLDRALAQKPRTAELAEQYASSFIFGELLLAVPVFIGWTLYADAHTALWITVALLVITCPCALSLATPTAL
    AASTGTLAREGILIGGKQAIETLAQTTDIIFDKTGTLTQGKPAVRRISLLRGTDEAFVLAVAQALEQQSEHPLARAILNC
    RISDGSVPDIAIKQRLNRIGEGVGAQLTVNGETQVWALGRASYVAEISGKEPQTEGGGSAVYLGSQSGFQAVFYLQDPLK
    DSAAEAVRQLAGKNLTLHILSGDRETAVAETARALGVAHYRAQAMPEDKLEYVKALQKEGKKVLMIGDGINDAPVLAQAD
    VSAAAAGGTDIARDGADIVLLNEDLRTVAHLLDQARRTRHIIRQNLIWAGAYNIIAVPLAVLGYVQPWIAALGMSFSSLA
    VLGNALRLHKRGKMQSEKMPSEQ

    >gi|218768344|ref|YP_002342856.1| thioredoxin reductase [Neisseria meningitidis Z2491]
    MSQHRKLIILGSGPAGYTAAVYAARANLNPVIITGIAQGGQLMTTTEVDNWPADADGVQGTELMARFLAHAERFGTEIIF
    DQINAVDLQKRPFTLKGDMGEYTCDALIVATGASAKYLGLPSEEAFAGKGVSA
    CATCDGFFYKNQDVAVVGGGNTAVEEA
    LYLANIAKTVTLIHRRSEFRAEKIMIDKLMKRVEEGKIILKLESNLQEVLGDDRGVNGALLKNNDGSEQQIAVSGIFIAI
    GHKPNTDIFKGQLEMDEAGYLKTKGGTADNVGATNIEGVWAAGDVKDHTYRQAITSAASGCQAALDAERWLGSQNI

    >gi|218768345|ref|YP_002342857.1| putative cation-transporting ATPase [Neisseria meningitidis Z2491]
    MQQKVRFQIEGMTCQACASRIEKVLNKKDFVESAGVNFASEEAQVVFDDSKTSVADIAKIIEKTGYGAKEKTEDTLPQPE
    AEHHIGWRLWLLLAINIPFLIGMVGMMLKGLNWTRHDWMLSPLLQFALASVVQLWLAVPFYKSAWASIKGGLANMDVLVT
    IGTVSIYLYSVYMLFFSPHAAYGMAHVYFEVGIMVIGFVSLGKFLEHRTKKSSLNSLGLLLKLTPTQVNVQRDGEWRQLP
    IDQVQIGDLIRANHGERIAADGIIESGSGWADESHLTGESNPEEKKAGGKVLAGALMTEGSVVYRAAQLGSQTLLGDMMN
    ALSEAQGSKAPIARVADKAAAVFVPAVVGIALLTFIATWLIKGDWTLALMHAVAVLVIACPCALGLATPAAIMVGMGKAV
    KHGIWFKDAAAMEEAAHVDAVVLDKTGTLTEGKPQVAAVYCVPDSGFDEDALYRIAAAVEQNAAHPLARAIVSAAQARGL
    EIPTAQNAQTIVGAGITAEVKGAGLVKAGKAEFAELTLPKFSDGVWEIASVVAVSVNGKPIGAFALADALKADTAEAIGR
    LKKHNIDVYIMSGDNQGTVEYVAKQLGIAHAFGNMSPRDKAAEVQKLKAAGKTVAMVGDGINDAPALAAANVSFAMKGGA
    DVAEHTASATLMQHSVNQLADALSVSRATLKNIKQNLFFAFFYNILGIPLAALGFLNPVIAGAAMAASSVSVLSNALRLK
    RVKID

    >gi|218768361|ref|YP_002342873.1| dihydrolipoamide dehydrogenase (E3 component of pyruvate and 2-oxoglutarate dehydrogenase complexes) [Neisseria meningitidis Z2491]
    MSLVELKVPDIGGHENVDIIAVEVNVGDTIAVDDTLITLETDKATMDVPAEVAGVVKEVKVKVGDKISEGGLIVVIEAEG
    AAAAPKAEAPVAPAQEAPKAAAPAPQAAQFGGSADVEYDVVVLGGGPGGYSAAFAAADEGLKVAIVERYKTLGGV
    CLNVG
    CIPSKALLHNAAVIDEVRHLAANGIKYPEPELDIDMLRGYKDGVVSRLTTGLAGMAKGRKVDIIQGDGQFLDPHHLEVSL
    TTSEVYEQATPTGEKKIVAFKNCIIAAGSRVTKLPFIPEDPRIFDSSGALALKEVPGKLLIIGGGIIGLEMGTVYSTLGS
    RLDVVEMMDGLMQGADRDLVKVWQKQNEYRFDNIMINTKTVAVEPKEDGVYVTFEGANAPKEPQRYDAVLVAAGRAPNGK
    LISAEKAGVAVTDRGFIEVDKQMRTNVPHIYAIGDIVGQPMLAHKAVHEGHVAAENCAGHKAYFDARVIPGVAYTSPEVA
    WVGETELSAKASGRKITKANFPWAASGRAIANGCDNGFTKLIFDAETGRIIGGGIVGPNGGDMIGEVCLAIEMGCDAADI
    GKTIHPHPTLGESIGMAAEVALGTCTDLPPQKKK

    >gi|218768383|ref|YP_002342895.1| thioredoxin I [Neisseria meningitidis Z2491]
    MSSELIVHTGDAAFEQDVLKSDLPVLLDFWAPWCGPCKMIAPILDDIAAEFEGRLKVVKINIDDNEATPSRFGVRGIPTL
    MVFKNGDVVATKVGALAKGQLTAFVEASIA

    >gi|218768398|ref|YP_002342910.1| HesB-like protein [Neisseria meningitidis Z2491]
    MITLTENAAKHINDYLAKRGKGLGVRLGVKTSGCSGMAYNLEFVDEADGDDLIFEGHGARIYIDPKSLVYLDGTQVDYTK
    EGLQEGFKFENPNVKDSCGCGESFHV

    >gi|218768501|ref|YP_002343013.1| thiol:disulfide interchange protein precursor [Neisseria meningitidis Z2491]
    MQTNYLSETDSIMKKLICLFAVFLMLCGRAFALDANDLLPPEKAFVPELAVADDGVNVRFRIADGYYMYQAKIVGKTDPA
    DLLGQPSFSKGEEKEDEFFGRQTVYHHEAQVAFPYAKAVGEPYKLVLTYQGCAEAGVCYPPVDTEFDISGNGTYHPQTDE
    PASAKDRFLQPSSQNGSGALPPPKGDEGGDSRFKLSWDTLNANLLAFFLAGLGLSFTACMYPLLPIVSSIVVGDKKAGKA
    RAFVLSVVYVQGLSLTYTLVGIVAGLTGALLTVWLQQAWVVLAASALMVVLALSMFGLFNIQLPNAVQSYFQNQSSRLSG
    GKIVSVFIMGILSALIVGPCVAPPLAFALGYIGQTGDAVLGGLALYTLALGTGVPLIAIGTFGGHILPRAGDWMNAVKYA
    FGFILLAVAVYLATPHLPYYLVVALYTLLMLVPACMLLVNGRRQKRRPKAVAFALGGILLIGGAWFGWQGANGKTTALHH
    FLTLNPPAEAGKSSEHGKMFADTAALKAAMDTALKEHPDKPVVLDFYADW
    CISCKEMAAYTLNQPEVHQAVDMERFFQID
    VTANTPEHQALLKEYGLFGPPGVFVVRSDGSRSEPLLGFVKADKFIEWYEQNR

    >gi|218768510|ref|YP_002343022.1| putative methylated-DNA-protein-cysteine methyltransferase [Neisseria meningitidis Z2491]
    MPQPDPQGFRRSLFLHRRAGMAKIGDFAVKSMIEIRSKRMITLPSLNNLPSKWDEIRYWLETRVCECGVMSHPNLTECEA
    GQFDRDFWDNIGCAPEEYVRIRRAIRLLEARYPDSLNELVCAAIATPLGEMLAVFGNKGLCLLEFVGQKHLEQEIAAVQK
    ALRGRFVFREDERTQLLRQELDLYFKGRLKTFATPLEQIGTEFQKQAWDALLAIPYGETRSYKEQAQRLGNPNAVRAVAA
    ANGQNKVSILIP
    CHRVIGSDGKLTGYAGGLNRKQFLLALERGEVQTALF

    >gi|218768546|ref|YP_002343058.1| putative lipoprotein [Neisseria meningitidis Z2491]
    MFSVPRSFLPGVFVLAALAACKPQDNSAAQVASSSASASAAENAAKPQTRGTDMRKEDIGGDFTLTDGEGKPFNLSDLKG
    KVVILSFGFTH
    CPDVCPTELLTYSDTLKQLGGQAKDVKVVFVSIDPERDTPEIIGKYAKQFNPDFIGLTATGDQNLPVIK
    QQYRVVSAKVNQKDDSENYLVDHSSGAYLIDKNGEVAIFSPYGSEPETIAADVRTLL

    >gi|218768559|ref|YP_002343071.1| hypothetical protein NMA1782 [Neisseria meningitidis Z2491]
    MFKDWKEHTALVKKSFGELGKAHPKMLQAYGALEQAAAAEALDAKTRELIAIAVAITTRCESCISVHAAAAAKAGATDSE
    IAGALATAIALNAGAAYTYALRALEAVETQK

    >gi|218768593|ref|YP_002343105.1| glutathione peroxidase [Neisseria meningitidis Z2491]
    MGIYDFQMKDAEGNAVDLSGYRGKVLLIVNTATRCGLTPQYEALQKLYAQYTAEGLEILDFPCNQFREQAPESSGEIAQV
    CMMKFGTKFKIFDKIEVNGANTAPLYAYLKSVKPQDKGNHLFKDFVLKLAALGEKRDEGDIKWNFTKFLVNRDGEVVERF
    APSVTPEEIEADIRALL

    >gi|218768671|ref|YP_002343183.1| putative disulphide bond formation protein [Neisseria meningitidis Z2491]
    MYFFVGIVRANRRFVPCHLGIYPAKSAYRYFDWCVEKMTPLFRKAVWLLFAVSVCAFAGSLAAQYVLGMEPCVLCISQRL
    CVLATALCAAIVLMCRPRRKAGGLFGAVFISIPAVTGISVAAYQLWLQSLPPGTAPS
    CGAPWTFRLKGWPLFDWFEPVVR
    GFGNCAEPDYLLGVALPVWSVAYFLAVALTVWWAWARAK

    >gi|218768746|ref|YP_002343258.1| glutaredoxin 2 [Neisseria meningitidis Z2491]
    MKLYIYDHCPFCVRARMAAGLFGADVEEAVLANDDEATPIGMIGAKQVPVLQKEDGSFMGESLDIVRHFDREDRLKDEVR
    PEIRAWLDKVGGYNDKLVQPRVIKIGLPEFATPEAVKYFTDKKEKSIGSFSANLNKTAQYLERINADLQELENLMDGASD
    GINGGIGMEDILVFPVLRNLTVVRGIEWPQKVMGYLMTMSEKSGVPLYFDRAL

    >gi|218768824|ref|YP_002343336.1| putative thiol:disulphide interchange protein [Neisseria meningitidis Z2491]
    MKLKHLLPLLLSAVLSAQAYALTEGEDYLVLDKPIPQKQSGKIEVLEFFGYFCVHCHHFDPLLLKLGKALPSDAYLRTEH
    VVWQPEMLGLARMAAAVKLSGLKYQANPAVFKAVYEQKIRLENRSVAEKWALSQKGFDGKKLMRAYDSPAAAAAASKMQQ
    LTEQYRIDSTPTVVVGGKYRVIFNNGFDGGVHTIKELVAKVREERKRQTPAVQK

    >gi|218768923|ref|YP_002343435.1| putative thiol:disulphide interchange protein [Neisseria meningitidis Z2491]
    MKLKTLALTSLTLLALAACSKQAETSVPADSAQSSSSAPAAPAELNEGVNYTVLSTPIPQQQAGKIEVLEFFGYFCPHCA
    HLEPVLSEHIKTFKDDTYMRREHVVWGDEMKPLARLAAAVEMAGESDKANSHIFDAMVNQKINLADTDTLKKWLSEQTAF
    DGKKVLAAFEAPESQARAAQMEELTNKFQISGTPTVIVGGKYQVEFKDWQSGMTTIDQLVDKVREEQKKPQ

    >gi|218768940|ref|YP_002343452.1| putative thiol:disulphide interchange protein [Neisseria meningitidis Z2491]
    MKSKHLALGVAALFALAACDSKVQTSVPADSAPAASAAAAPAGLVEGQNYTVLANPIPQQQAGKVEVLEFFGYFCPHCAH
    LEPVLSKHAKSFKDDMYLRTEHVVWQKEMLTLARLAAAVDMAAADSKDVANSHIFDAMVNQKIKLQEPEVLKKWLGEQTA
    FDGKKVLAAYESPESQARADKMQELTETFQIDGTPTVIVGGKYKVEFADWESGMNTIDLLADKVREEQKAAH