Neisseria meningitidis MC58 uid57817

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|15675953|ref|NP_273071.1| arsenate reductase [Neisseria meningitidis MC58]
    MPEIKIFHNPRCSKSRAALSLLEERGIAAEVVKYLDTPPDLSELKDIFNKLGLASARGMMRVKDDLYKELGLDNPNLDND
    ALLRAIADHPALLERPIVLANGKAAVGRPLENIEAVL

    >gi|15675954|ref|NP_273072.1| thioredoxin-related protein [Neisseria meningitidis MC58]
    MKYLNLAAITLAATFAAHTASADELAGWKDNTPQSLQSLKAPVRIVNLWATWCGPCRKEMPAMSKWYKAQKKGSVDMVGI
    ALDTSDNIGNFLKQTPVSYPIWRYTGANSRNFMKTYGNTVGVLPFTVVEAPKCGYRQTITGEVNEKSLTDAVKLAHSKCR


    >gi|15675984|ref|NP_273110.1| trifunctional thioredoxin/methionine sulfoxide reductase A/B protein [Neisseria meningitidis MC58]
    MKHRTFFSLCAKFGCLLALGACSPKIVDAGAATVPHTLSTLKTADNRPASVYLKKDKPTLIKFWASWCPLCLSELGQTEK
    WAQDAKFSSANLITVASPGFLHEKKDGDFQKWYAGLNYPKLPVVTDNGGTIAQSLNISVYPSWALIGKDSDVQRIVKGSI
    NEAQALALIRDPNADLGSLKHSFYKPDTQKKDSKIMNTRTIYLAGG
    CFWGLEAYFQRIDGVVDAVSGYANGNTKNPSYED
    VSYRHTGHAETVKVTYDADKLSLDDILQYFFRVVDPTSLNKQGNDTGTQYRSGVYYTDPAEKAVIAAALKREQQKYQLPL
    VVENEPLKNFYDAEEYHQDYLIKNPNGYCHIDIRKADEPLPGKTKTAPQGKGFDAATYKKPSDAELKRTLTEEQYQVTQN
    SATEYAFSHEYDHLFKPGIYVDVVSGEPLFSSADKYDSGCGWPSFTRPIDAKSVTEHDDFSYNMRRTEVRSHAADSHLGH
    VFPDGPRDKGGLRY
    CINGASLKFIPLEQMDAAGYGALKGKVK

    >gi|15676202|ref|NP_273334.1| thiol:disulfide interchange protein DsbA [Neisseria meningitidis MC58]
    MKSRHLALGVAALFALAACDSKVQTSVPADSAPAASAAAAPAGLVEGQNYTVLANPIPQQQAGKVEVLEFFGYFCPHCAH
    LEPVLSKHAKSFKDDMYLRTEHVVWQKEMLTLARLAAAVDMAAADSKDVANSHIFDAMVNQKIKLQNPEVLKKWLGEQTA
    FDGKKVLAAYESPESQARADKMQELTETFQIDGTPTVIVGGKYKVEFADWESGMNTIDLLADKVREEQKAAQ

    >gi|15676216|ref|NP_273348.1| thiol:disulfide interchange protein DsbA [Neisseria meningitidis MC58]
    MKLKTLALTSLTLLALAACSKQAETSVPADSAQSSSSAPAAPAELNEGVNYTVLSTPIPQQQAGKIEVLEFFGYFCPHCA
    HLEPVLSEHIKTFKDDTYMRREHVVWGDEMKPLARLAAAVEMAGESDKANSHIFDAMVNQKINLADTDTLKKWLSEQTAF
    DGKKVLAAFEAPESQARAAQMEELTNKFQISGTPTVIVGGKYQVEFKDWQSGMTTIDQLVDKVREEQKKPQ

    >gi|15676320|ref|NP_273456.1| thiol:disulfide interchange protein DsbA [Neisseria meningitidis MC58]
    MKLKHLLPLLLSAVLSAQAYALTEGEDYLVLDKPIPQEQSGKIEVLEFFGYFCVHCHHFDPLLLKLGKALPSDAYLRTEH
    VVWQPEMLGLARMAAAVNLSGLKYQANPAVFKAVYEQKIRLENRSVAGKWALSQKGFDGKKLMRAYDSPEAAAAALKMQK
    LTEQYRIDSTPTVIVGGKYRVIFNNGFDGGVHTIKELVAKVREERKRQTPAVQK

    >gi|15676456|ref|NP_273595.1| thiol:disulfide interchange protein DsbC [Neisseria meningitidis MC58]
    MKTKLIKILTPFTVLPLLACGQTPVSNANAEPAVKAESAGKSVAASLKARLEKTYSAQDLKVLSVSETPVKGIYEVVVSG
    RQIIYTDAEGGYMFVGELINIDTRKNLTEERAADLNKIDFASLPLDKAIKEVRGNGKLKVAVFSDPD
    CPFCKRLEHEFEK
    MTDVTVYSFMMPIAGLHPDAARKAQILWCQPDRAKAWTDWMRKGKFPVGGSICDNPVAETTSLGEQFGFNGTPTLVFPNG
    RSQSGYSPMPQLEEIIRKNQ

    >gi|15676462|ref|NP_273601.1| iron-sulfur cluster insertion protein ErpA [Neisseria meningitidis MC58]
    MSDESPIIFTDSCCAKVADLIAEENNPDLKLRVFVNGGGCSGFQYGFTFDEIKNDDDFEIEKNGLVFLVDPMSYQYLVGA
    EIDYTESLQGSQFVIRNPNAETTCGCGSSFSV

    >gi|15676470|ref|NP_273609.1| Na(+)-translocating NADH-quinone reductase subunit E [Neisseria meningitidis MC58]
    MEHYLSLFIKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVIFVLGLSVPVNQLVYSLLKDGAIAEGVDLTFLKFI
    TFIGVIAALVQILEMFLDKFVPALYNALGIYLPLITVN
    CAIFGAVSFMAQREYNFGESVVYGFGAGLGWMLAIVALAGIT
    EKMKYSDAPKGLKGLGITFIAAGLMAMAFMSFSGIQL

    >gi|15676471|ref|NP_273610.1| Na(+)-translocating NADH-quinone reductase subunit D [Neisseria meningitidis MC58]
    MADMKRLKHLMFSPFIDNNPIALQVLGICSALAVTTKLQTAIVMGISVALVTGFSSFFISLVRNYIPNSIRIIVQMAIIA
    SLVTLVDQLLQAFAYELSKQLSVFVGLIITN
    CIVMGRAEAFAMKEPPLESLIDGIGNGAGYGIMLLVVATVRELIGSGKL
    LGYTVFQTVQDGGWYQTNGLFLLAPSAFFIIGFLIWGLRTWKPEQAEE

    >gi|15676648|ref|NP_273792.1| bacterioferritin comigratory protein [Neisseria meningitidis MC58]
    MDVKYEFTLPSSSGADFHSAEHLPLVVYFYPKDSTLGCTTEGLDFNARLEQFEALGYTVVGISRDGVKAHQNFCAKQGFR
    FELLSDKDETVCRLFDVIKLKKLYGKESLGIERSTFVLNKDGEIAHEWRKVKVAGHAQEVLETLSR

    >gi|15676651|ref|NP_273795.1| hypothetical protein NMB0753 [Neisseria meningitidis MC58]
    MKLTLMFREYCSLCHKMRDELKPFQDEYGFGLEVVDVDENPVLEEKYNELVPVLLAGDEEICHWFLDEDRLKQFLER

    >gi|15676671|ref|NP_273815.1| hypothetical protein NMB0773 [Neisseria meningitidis MC58]
    MASIHDQIKEVVTTHRVVLFMKGTKQFPQCGFSSRAVQILNAAGCTDYVTVNVLENPEVRQGIKEYSDWPTIPQLYVNGE
    FVGGSDILMEMYEAGELQELLKA

    >gi|15676682|ref|NP_273826.1| putative phage shock protein E precursor [Neisseria meningitidis MC58]
    MNIKHLITAALIASAAFAAQAAPQKPVSAAQTAQHPAVWIDVRSEQEFSEGHLHNAVNIPVDQIVRRIHEAAPDKDTPVN
    LY
    CRSGRRAEAALQELKKAGYTNVANHGGYEDLLKKGMK

    >gi|15676839|ref|NP_273984.1| peroxiredoxin 2 family protein/glutaredoxin [Neisseria meningitidis MC58]
    MALQDRTGQKVPSVVFRTRVGDTWKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYNELFGAFKENGVDAIYCVSVN
    DTFVMNAWAAEEESDNIYMIPDGNGEFTEGMGMLVGKEDLGFGKRSWRYSMLVNDGVVEKMFIEPEEPGDPFKVSDADTM
    LQFVAPDWKAQESVAIFTKPG
    CQFCAKAKQALQDKGLSYEEIVLGKDATVTSVRAITGKMTAPQVFIGGKYIGGSEDLEA
    YLAKN

    >gi|15676840|ref|NP_273985.1| dihydrolipoamide dehydrogenase [Neisseria meningitidis MC58]
    MKKIQADVVVIGGGTAGMGAFRNARLHSDNVYLIENNVFGTTCARVGCMPSKLLIAAAEARHHALHTDPFGVHLDKDSIV
    VNGEEVMQRVKSERDRFVGFVVADVEEWPADKRIMGSAKFIDEHTVQIDEHTQITAKSFVIATGSRPVILPQWQSLGNRL
    IINDDVFSWDTLPKRVAVFGPGVIGLELGQALHRLGVKVEIFGLGGIIGGISDPVVSDEANAVFGEELKLHLDAKTEVKL
    DADGNVEVHWEQDGEKGVFVAEYMLAAVGRRPNVDNIGLENINIEKDARGVPVADPLTMQTSIPHIFIAGDASNQLPLLH
    EAADQGKIAGDNAGRYPNIGGGLRRSTIGVVFTSPQIGFVGLKYAQVAAQYQADEFVIGEVSFKNQGRSRVMLVNKGHMR
    LYAEKATGRFIGAEIVGPAAEHLAHLLAWAHQMKMTVPQMLDMPFYHPVIEEGLRTALRDADAKLKA

    >gi|15676850|ref|NP_273995.1| dihydrolipoamide dehydrogenase [Neisseria meningitidis MC58]
    MSQYDVVVIGAGPGGYVAAIRAAQLGFKTACVDAGVNKAGNAPALGGTCLNVGCIPSKALLQSSEHFHAAQHEFAEHGIT
    VGDVKFDAAKMIERKDAIVTKLTGGVKFLFQKNKVTSLFGTASFAGKNGDAYQIEVDNKGEKTVIEAKHVIVATGSVPRP
    LPQVAIDNVNVLDNEGALNLTEVPAKLGVIGSGVIGLEMGSVWNRVGAEVTILEAAPTFLAAADQQIAKEAFKYFTKEQG
    LSIELGVKIGDIKSEGKGVSVAYETAAGEAKTEVFDKLIVAIGRIPNTKGLNAEAVGLEKDERGFIKVDGECRTNLPNVW
    AIGDVVRGPMLAHKASDEGVAVAERIAGQKPHIDFNNVPFVIYTDPEIAWVGKTEEQLKAEGVEYKKGTSGFGANGRALA
    MGKAKGTVKVLADAKTDRILGVHMIGPVVSELVTEGVTALEFFASSEDIARIIHAHPTLSEVVHEAALAADKRALHG

    >gi|15676886|ref|NP_274031.1| macrophage infectivity potentiator-related protein [Neisseria meningitidis MC58]
    MPSEKCSDGISYNLLFAAHNQSVFPIPFRNAYHAPVPNICEQGKKMARLTVHTLETAPEAAKARVEAVLQNNGFIPNLIG
    VLSNAPEALAFYQEVGKLNAANSLTAGEVEVIQIIAARTNQCGF
    CVAGHTKLATLKKLLSEQSVKAARALAAGEFDDAKL
    GALAAFTQAVMAKKGAVSDEELKAFFDAGYNQQQAVEVVMGVALATLCNYVNNLGQTEINPELQAYA

    >gi|15676928|ref|NP_274076.1| cation transporter E1-E2 family ATPase [Neisseria meningitidis MC58]
    MKKTCFHCGLDVPEHLHLTVRYENEDRETCCAGCQAVAQSIIDAGLGSYYKQRTADAQKTELPPQEILDQIRLYDLPEVQ
    SDFVETHGGTREAVLMLGGIT
    CAACVWLIEQQLLRTDGIVRIDLNYSTHRCRVVWDDGKIRLSDILLKIRQIGYTAAPYD
    AQKIEAANQKERKQYIVRLAVAGLGMMQTMMFALPTYLYGGDIEPDFLQILHWGGFLMVLPVVFYCAVPFYQGALRDLKN
    RRVGMDTPITVAIIMTFIAGVYSLATNAGQGMYFESIAMLLFFLLGGRFMEHIARRKAGDAAERLVKLIPAFCHHMPDYP
    DTQETCEAAVVKLKAGDIVLVKPGETIPVDGTVLEGSSAVNESMLTGESLPVAKMPSEKVTAGTLNTQSPLIIRTDRTGG
    GTRLSHIVRLLDRALAQKPRTAELAEQYASSFIFGELLLAVPVFIGWTLYADAHTALWITVALLVITCPCALSLATPTAL
    AASTGTLAREGILIGGKQAIETLAQTTDIIFDKTGTLTQGKPAVRRISLLRGTDEAFVLAVAQALEQQSEHPLARAILNC
    RISDGSVPDIAIKQRLNRIGEGVGAQLTVNGETQVWALGRASYVAEISGKEPQTEGGGSAVYLGSQSGFQAVFYLTDPLK
    DSAAEAVRQLAGKNLTLHILSGDRETAVAETARALGVAHYRAQAMPEDKLEYVKALQKEGKKVLMIGDGINDAPVLAQAD
    VSAAAAGGTDIARDGADIVLLNEDLRTVAHLLDQARRTRHIIRQNLIWAGAYNIIAVPLAVLGYVQPWIAALGMSFSSLA
    VLGNALRLHKRGKMQSEKMPSEQ

    >gi|15677111|ref|NP_274263.1| hypothetical protein NMB1239 [Neisseria meningitidis MC58]
    MIVLHGIPNCDTVKKAKNRLAGYGLEFEFRDFKKQRPSEAEICSWLEQVPLATLLNKRGTSWRKLDAETQQKVLSSTAEA
    VKLMSEMPSLIKRPVLECGGKVYAGFSEETYDGIFNRQAPCRQG

    >gi|15677190|ref|NP_274343.1| thioredoxin reductase [Neisseria meningitidis MC58]
    MSQHRKLIILGSGPAGYTAAVYAARANLNPVIITGIAQGGQLMTTTEVDNWPADADGVQGPELMARFLAHAERFGTEIIF
    DQINAVDLQKRPFTLKGDMGEYTCDALIVATGASAKYLGLPSEEAFAGKGVSA
    CATCDGFFYKNQDVAVVGGGNTAVEEA
    LYLANIAKTVTLIHRRSEFRAEKIMIDKLMKRVEEGKIILKLESNLQEVLGDDRGVNGALLKNNDGSEQQIAVSGIFIAI
    GHKPNTDIFKGQLEMDEAGYLKTKGGTADNVGATNIEGVWAAGDVKDHTYRQAITSAASGCQAALDAERWLGSQNI

    >gi|15677191|ref|NP_274344.1| cation transporter E1-E2 family ATPase [Neisseria meningitidis MC58]
    MQQKIRFQIEGMTCQACASRIEKVLNKKDFVESAGVNFASEEAQVVFDDSKTSVADIAKIIEKTGYGAKEKTEDTLPQPE
    AEHHIGWRLWLLFTINVPFLIGMAGMMIGRHDWMIPPLWQFALASVVQLWLAIPFYKSAWASIKGGLANMDVLVTIGTVS
    IYLYSVYMLFFSPHAAYGMAHVYFEVGVMVIGFVSLGKFLEHRTKKSSLNSLGLLLKLTPTQVNVQRNGEWKQLPIDQVQ
    IGDLIRANHGERIAADGIIESGSGWADESHLTGESNPEEKKAGGKVLAGALMTEGSVVYRATQLGSQTQLGDMMNALSEA
    QGSKAPIARVADKAAAVFVPAVVGIALLTFIVTWLIKGDWTVALMHAVAVLVIACPCALGLATPAAIMVGMGKAVKHGIW
    FKDAAAMEEAAHVDAVVLDKTGTLTEGSPQVAAVYCVPDSGFDEDALYRIAAAVEQNAAHPLARAIVSAAQARGLDIPAA
    QNAQTVVGAGITAEVEGVGLVKAGKAEFAELALPKFLDGVWDIASIVAVSVDNKPIGAFALADALKADTAEAIGRLKKHN
    IDVYIMSGDNQGTVEYVAKQLGIAHAFGNMSPRDKAAEVQKLKAAGKTVAMVGDGINDAPALAAANVSFAMKGGADVAEH
    TASATLMQHSVNQLADALLVSQATLKNIKQNLFFAFFYNILGIPLAALGFLNPVIAGAAMAASSVSVLSNALRLKRVKID


    >gi|15677210|ref|NP_274363.1| dihydrolipoamide dehydrogenase (E3 component of pyruvate and 2-oxoglutarate dehydrogenase complexes) [Neisseria meningitidis MC58]
    MALVELKVPDIGGHENVDIIAVEVNVGDTIAVDDTLITLETDKATMDVPAEVAGVVKEVKVKVGDKISEGGLIVVVEAEG
    TAAAPKAEAAAAPAQEAPKAAAPAPQAAQFGGSADAEYDVVVLGGGPGGYSAAFAAADEGLKVAIVERYKTLGGV
    CLNVG
    CIPSKALLHNAAVIDEVRHLAANGIKYPEPELDIDMLRAYKDGVVSRLTGGLAGMAKSRKVDVIQGDGQFLDPHHLEVSL
    TAGDAYEQAAPTGEKKIVAFKNCIIAAGSRVTKLPFIPEDPRIIDSSGALALKEVPGKLLIIGGGIIGLEMGTVYSTLGS
    RLDVVEMMDGLMQGADRDLVKVWQKQNEYRFDNIMVNTKTVAVEPKEDGVYVTFEGANAPKEPQRYDAVLVAAGRAPNGK
    LISAEKAGVAVTDRGFIEVDKQMRTNVPHIYAIGDIVGQPMLAHKAVHEGHVAAENCAGHKAYFDARVIPGVAYTSPEVA
    WVGETELSAKASGRKITKANFPWAASGRAIANGCDNGFTKLIFDAETGRIIGGGIVGPNGGDMIGEVCLAIEMGCDAADI
    GKTIHPHPTLGESIGMAAEVALGTCTDLPPQKKK

    >gi|15677231|ref|NP_274384.1| thioredoxin I [Neisseria meningitidis MC58]
    MSSELIVHTSDAAFEKDVLNADIPVLLDFWAPWCGPCKMIAPILDDIAAEFEGRLKVVKINIDDNEATPSRFGVRGIPTL
    MVFKNGEVVATKVGALAKGQLTAFVEASIA

    >gi|15677244|ref|NP_274397.1| HesB/YadR/YfhF family protein [Neisseria meningitidis MC58]
    MPSEPPAASGPSGAVQQGRNMITLTENAAKHINDYLAKRGKGLGVRLGVKTSGCSGMAYNLEFVDEADGDDLIFEGHGAR
    IYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV

    >gi|15677372|ref|NP_274527.1| thiol:disulfide interchange protein precursor [Neisseria meningitidis MC58]
    MKKLICLFAVFLMLCGRAFALDANDLLPPEKAFVPELAVADDGVNVRFRIADGYYMYQAKIVGKTDPADLLGQPSFSKGE
    EKEDEFFGRQTVYHHEAQVAFPYAKAVGEPYKLVLTYQGCAEAGVCYPPVDTEFDIFGNGTYHPQTDEPASAKDRFLQPS
    SQNGSGALPPPKGDEGGDSRFKLSWDTLNANLLAFFLAGLGLSFTACMYPLLPIVSSIVVGDKKAGKARAFVLSVVYVQG
    LALTYTLVGIVAGLTGALLTVWLQQAWVVLAASALMVVLALSMFGLFNIQLPNAVQSYFQNQSSRLSGGKIVSVFIMGIL
    SALIVGPCVAPPLAFALGYIGQTGDAVLGGLALYTLALGTGVPLIAIGTFGGHILPKAGDWMNAVKYAFGFILLAVAVYL
    ATPHLPYYLVVALYTLLMLVPAFMLLVNGRRQKRRPKAVAFALGGILLIGGAWFGWQGANGKTTALHHFLTLNPPAEAGK
    SSEHGKMFADTAALKAAMDTALKEHPDKPVVLDFYADW
    CISCKEMAAYTLNQPEVHQAVDMERFFQIDVTANTPEHQALL
    KEYGLFGPPGVFVVRSDGSRSEPLLGFVKADKFIEWYEQNR

    >gi|15677380|ref|NP_274535.1| putative methylated-DNA--protein-cysteine methyltransferase [Neisseria meningitidis MC58]
    MAKIGDFAVKSMIGIRSKQMITLPSLNNLPSKWDEIRHWLESRVFECGVMPHPNLTECEAKQFERDFWDNIGCAPEEYVR
    IRRAIRLLEARYPDSLNELVCAAIATPLGEMLAVFGSRGLCLLEFVGQKHLEQEIAAVQKALRGRFVFREDERTQLLRQE
    LDLYFKGRLKTFATPLEQIGTEFQKQAWDALLAIPYGETRSYKEQAQRLGNPKAVRAVAAANGQNKVSILIP
    CHRVIGSD
    GKLTGYAGGLNRKQFLLALEHGEVQTALF

    >gi|15677415|ref|NP_274571.1| hypothetical protein NMB1564 [Neisseria meningitidis MC58]
    MQVTSKWIDGMCFVGTTEGGHSVVMEGSAAEGKAKRGPSPLEMLLLGVAGCSSIDVVMIAEKQRQKVTDCRATVTAKRAD
    DAPRVFTEIHIHFKVFGHDLKESAIERAVQMSAEKYCSASIMLGKAAKITHSFEIAGADK

    >gi|15677428|ref|NP_274584.1| hypothetical protein NMB1578 [Neisseria meningitidis MC58]
    MFSVPRSFLPGVFVLAALAACKPQDNSAAQVASSSASASAAENAAKPQTRGTDMRKEDIGGDFTLTDGEGKPFNLSDLKG
    KVVILSFGFTH
    CPDVCPTELLTYSDTLKQLGGQAKDVKVVFVSIDPERDTPEIIGKYAKQFNPDFIGLTATGGQNLPVIK
    QQYRVVSAKVNQKDDSENYLVDHSSGAYLIDKNGEVAIFSPYGSEPETIAADVRTLL

    >gi|15677440|ref|NP_274596.1| hypothetical protein NMB1590 [Neisseria meningitidis MC58]
    MFKDWKEHTALVKKSFGELGKAHPKMLQAYGALEQAAAAEALDAKTRELIAIAVAITTRCESCISVHAAAATKAGATDSE
    IAGALATAIALNAGAAYTYALRALEAVETQK

    >gi|15677471|ref|NP_274627.1| glutathione peroxidase [Neisseria meningitidis MC58]
    MGIYDFQMKDAEGNAVDLSGYRGKVLLIVNTATRCGLTPQYEALQKLYAQYTAEGLEILDFPCNQFREQAPESSGEIAQV
    CMMKFGTKFKIFDKIEVNGANTAPLYAYLKSVKPQDKGNHLFKDFVLKLAALGEKRDEGDIKWNFTKFLVNRDGEVVERF
    APSVTPEEIEADIRALL

    >gi|15677498|ref|NP_274654.1| disulfide bond formation protein B [Neisseria meningitidis MC58]
    MTPLFRKAVWLLFAVSVCAFAGSLAAQYVLGMEPCVLCISQRLCVLATALCTAIVLMCRPRRRAGGLFGAVFISIPAVTG
    ISVAAYQLWLQSLPPGTAPS
    CGAPWTFRLKGWPLFDWFEPVVRGFGNCAEPDYLLGIALPVWSVAYFLAVVLTVWWAWAR
    AK

    >gi|15677580|ref|NP_274737.1| glutaredoxin 2 [Neisseria meningitidis MC58]
    MKLYIYDHCPFCVRARMAAGLFGADVEEAVLANDDEATPIGMIGAKQVPVLQKEDGSFMGESLDIVRHFDREDRLKDEVR
    PEIRAWLDKVGGYNDKLVQPRVIKIGLPEFATPEAVKYFTDKKEKSIGSFSANLNKTAQYLERINADLQELENLMDGASD
    GINGGIGMEDILVFPVLRNLTVVRGIEWPQKVMGYLMTMSEKSGVPLYFDRAL

    >gi|15677630|ref|NP_274789.1| glutaredoxin 3 [Neisseria meningitidis MC58]
    MQTVTMYTGPFCPYCAMAKRLLHAAGVGHIDEIRVDASPEAFAEMQQLSGQRSVPQIFIGETHVGGFTDLYRLQQEGGLD
    GLLNP

    >gi|15677681|ref|NP_274842.1| thioredoxin [Neisseria meningitidis MC58]
    MKKKLLSGIKFAVQTALVFLLVSLFLDWIRKPEEPAGAAGRPLTLLSGQRLTLGQFSRDKAVLVYFWGSWCGVCRYQSPI
    IDDLAADGVPVVGVAVRSGSSAEVAAYMAKRGLGFPTVNDEDGGLARSWRIVATPAVVLVKNGKMVHYTTGISSYWGLRA
    RIFQADVFG

    >gi|15677719|ref|NP_274880.1| hypothetical protein NMB1884 [Neisseria meningitidis MC58]
    MDIVQLGPAELKAWMDEGRMFCLLDVRTDEETAVCSLPNALHIPMNLIPLRQNELPDDVPLVVYCHHGIRSLHTAMYLAD
    AGFENLYNLQGGIDAWAAEIDGNMMRY

    >gi|15677783|ref|NP_274947.1| stringent starvation protein A [Neisseria meningitidis MC58]
    MMTLYSGITCPFSHRCRFVLYEKGMDFEIKDVDIYNKPEDLAVMNPYNQVPVLVERDLVLHESNIINEYIDERFPHPQLM
    PGDPVMRGRGRLVLYRMEKELFNHVQVLENPAATNKEQAKAREAIGNGLTMLAPSFSKSKYILGEDFSMIDVALAPLLWR
    LDHYDVKLGKSAAPLLKYAERIFQREAFIEALTPAEKAMRK

    >gi|15677788|ref|NP_274952.1| putative thioredoxin [Neisseria meningitidis MC58]
    MKKILTAAVVALIGILLAIVLIPDSKTAPAFSLPDLHGKTVSNADLQGKVTLINFWFPSCPGCVSEMPKIIKTANDYKNK
    NFQVLAVAQPIDPIESVRQYVKDYGLPFTVMYDADKAVGQAFGTQVYPTSVLIGKKGEILKTYVGEPDFGKLYQEIDTAW
    RNSDAV

    >gi|15677884|ref|NP_275052.1| thiF protein [Neisseria meningitidis MC58]
    MTTTEHDNDDAFLLRYSRHILLDEIGIEGQQKLSAAHILVVGCGGLGAAALPYLAASGVGTLTIADSDTVELHNLQRQVA
    FDEGDVGKLKTEALAGRLKRINHTVNVRAVNEKLDGCRLTGLVQAADIVLDCCDNYATRQAVNRACVQTKTPLVSGAAVR
    FEGQLAVYRPDLPDSPCYACLFDGGSASDGI
    CSLFGVFSPLVGIIGSTQAAEALKILLDAGEPSHGRLAVYRALEGGWQY
    FDLPRNPECPVCGTAR