Arthrobacter arilaitensis Re117 uid53509

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|308171889|ref|YP_003915219.1| glutaredoxin-like protein [Arthrobacter arilaitensis Re117]
    MVTVYTTGPGCIRCKMTKDVMTKRGVEFVEVDIRQNAAAREYVTEELGYSEAPVCVVEDGTGEDHWSGFRPDNISRLAAL
    ANGGE

    >gi|308175874|ref|YP_003915280.1| rhodanese domain-containing protein [Arthrobacter arilaitensis Re117]
    MSDFETVSVNDVPKDAFILDVREDFEWEAGRAAGATHVVLGTLPERVGELDPDVDTYVICRTGGRSAQAAAWLTGMGYTA
    FNIAGGSDAWLEAGLPMEAENGQEPTVR

    >gi|308175948|ref|YP_003915354.1| thioredoxin [Arthrobacter arilaitensis Re117]
    MKPLELSAANFERFIGNNQMVLVDFWAPWCGPCKRFAPVFELAAEAHEGIAFAKVNTETQPELARTMQIASIPTLVAFKN
    GILVHSKPGALKAAALEPLLMKLQKPVDPPSLPRRE

    >gi|308175950|ref|YP_003915356.1| rhodanese domain-containing protein [Arthrobacter arilaitensis Re117]
    MTSALNTMDAAALKCLVDAPDADLALIDVRTAGEFETVHIPGSYNVPLEEFTANAAEVLAKIPGTPVLICHSGNRASKAQ
    RALNEQQLGHSTVLIGGVTAYENAGGTMVRGVQRWALDRQMRMTAGSLVLAGLLGAKFISPKFAYLSAGIGGGLVFSAVR
    DSCPMISALGKMPWNKVAK

    >gi|308175951|ref|YP_003915357.1| metallo-beta-lactamase superfamily protein [Arthrobacter arilaitensis Re117]
    MLLERLYDEDLAQASYFIGCQAKGEALVVDARRDISDYLALAAKHGMRITAVAETHIHADYLSGTRELAAATGATSYVSG
    EGGKDWQYGFEAERLMDGDAIVLGNLRITARHTPGHTPEHLAYAVTDGAFSKTPGYLLSGDFIFAGDLGRPDLLDEAAGG
    VDTRFQGARDLYASLKKTLAELPDYIQIHPGHGSGSACGKALGAVPSTTLGYEREFAWWSTYLANDDQEGFIAELLNGQP
    DAHAYFGRMKRQNRLGPAVLGELEALEEVPAARIVEQIRSGASAFVDTRGPTQIAEGTVAGALSIPGTAKTASFGAWAYD
    PEKDERDLIVLADSVEHAAQIRAHLMRVGIDAVKGFTTSLEGLTLVKPKSITPAQLEGFDYAMLLDVRNKTEFAAGHIPG
    ATQLSGGRVLWNQDQLPTSGAIVTY
    CQSGMRNAVAASALRDAGFEIIELQGSYLGWSVFAN

    >gi|308175954|ref|YP_003915360.1| OsmC-like protein [Arthrobacter arilaitensis Re117]
    MLDVTLETPTSMGGPGGATNPEQLFAAGWASCFHSALKLVAAKRRVKIADSTVTAEVSLRKTPEGGFGLEAALQVNFAAG
    LNKEMADELVDAAHAV
    CPYSNATRGNIPVTLTSVVA

    >gi|308176050|ref|YP_003915456.1| methylated-DNA--[protein]-cysteine S-methyltransferase [Arthrobacter arilaitensis Re117]
    MNKSKAQEPGTEDSAVLASLGQKLAAQAHEQALVDVAYRIVDSPLGSLLLASTQNGLARVAFESEDHDRILELLSEKLGS
    RILRDAKRLDAAARQLDEYFSGQRQGFELALDLTLSTDFRRQVQLQLGQIAYGQTCSYAQMAQQIGKPKAVRAVGSACAT
    NPIPIVLP
    CHRVLRTDGSLGGYLGGLEAKSELLKLENPHFAEQGATLF

    >gi|308176124|ref|YP_003915530.1| DSBA-like thioredoxin domain-containing protein [Arthrobacter arilaitensis Re117]
    MSENTAAPSAQDKRIRVDIFSDIACPWCFIGKRRFEKGVESFEYSQNVDVYWHSYQLDPSLPDNYDGSEAEYLSKMKGLG
    QEQVMQMLDHVTAQAAGEGLNYDFENLKVANSFTALRVLEYAKQHGAGNEMKEALLSAHFEKGLNTGDEETLLQLAGQLG
    LDTDELRTNLASGAYAEEVNADIAQARELGISGVPFFIIDGKYGISGAQPAEVFANALTQVHSGNVQGA

    >gi|308176257|ref|YP_003915663.1| molybdopterin biosynthesis protein MoeB [Arthrobacter arilaitensis Re117]
    MKSERDFPALVAPGPPLSEERVARAARQLSLPGFDQAAQRRLAAARVLVIGAGGLGSASVPYLVGAGVGTIGIVDDDLVE
    LSNLHRQVTHTTANIGLAKTASLAQAATALDPNVKIIEHNLRLDSSNALEIFANYDLVIDGSDNFPTRYLSNDAAQLSGI
    PLIWGSILQHHGQVSVAWHEHGPGYRDLFPVPPAPGTVPD
    CAAGGVLPGLCGTVGSLLATEALKLIAGIGTPLVGKVLIY
    DALAASTRTLEYSRDPQAPEISELIDYVLFCSGTLPEAEGIDAESLAELLAGTDAPVLLDVRNDDEHAQQHITGSLHLPL
    PELEAAIESGTELEQIPAQVTVY
    CARGPRSQRAASLLASRGIKTNYLEGGLPALAAVEPQLLAKPATTEGNRS

    >gi|308176453|ref|YP_003915859.1| copper chaperone CopZ [Arthrobacter arilaitensis Re117]
    MATPTTPTTHTVLRAEGFSCPSCVAKIEKQVGRLKGVENVKVHFASARIEVDHDAERISVDDLVAAIAKAGYRAAPSAF

    >gi|308176541|ref|YP_003915947.1| hypothetical protein AARI_07530 [Arthrobacter arilaitensis Re117]
    MAQRLAGSSSQYLRQHSHQLVDWFPYGDEAFEQARLRDVPVMLSIGYAACHWCHVMSHESFDDSEIAALLNENFVAIKVD
    REEHPLVDDTYMLATQALTGAGGWPMTIFTLPDGRTVHAGTYYPKEPRGKTPSFRQVLNAVHEAWETKRAGLVEQAQMLA
    EHLAELGSRQSALLSLQSQQPADQAFSTALDRWMAAGKPEGGFTPAPKFPPTWALKTLSRAVITEPQRAEEAFEAAATHL
    EAIFLGGLQDHVDGGFARYCVDANWSVPHFEKMLYDNAGLLSLAARTSVLAAEMALKGQGDTAQRAQKLAGLAQRSAQGI
    ITFLEEELLTNSSSTPALAASLDADSSRDGHQVEGAYYTLNREEIAQVTDPLIQRLPKGLLRFGPVAEDPQNFCFSLLRT
    PEASELEVLQELREQMRTLRRSRIMPIRDEKVIAGWNGLAIEALCEAALLLEAPDALKLAAQAAESVWQMQWDQQNKRLA
    RVSFAGAATHANEGTLQDYSALALGFLALHQATGQQQWAQRAKDLLGRAADFVDPESGVPRDTVQSDARITAQRSSIAAV
    TVLDDAMPASGALYAKALAVQALQSMAAGEYTDADAAALESARGLSAHALALASEAPTQVATALEVQCIISSPVHYLAIS
    QWDSDQAKRVRSVAMSLGINVRHDPSLPHADQGLQIQPCREELCQIPVLGIEGLFSLFSAPKNA

    >gi|308176695|ref|YP_003916101.1| putative thiol peroxidase [Arthrobacter arilaitensis Re117]
    MANTAFKGTPVQTIGELPAVGSQAPAFTLTDTGLADVTSESLAGRRVVLNIFPSVDTGVCAASVRRFNELAAGLENTTVV
    CVSADLPFALGRFCGAEDIENVTAASVFRSDFGSDYGVTQIDGPLAGLLARSVIVLDETGKVTYTQVVPEITTEPDYDAT
    IAALS

    >gi|308176869|ref|YP_003916275.1| dihydrolipoyl dehydrogenase [Arthrobacter arilaitensis Re117]
    MTSPAAFQVDKHYDLIILGTGSGNSIPGPEFDGKSIAIIEKGAFGGTCLNVGCIPTKMYVYAADVALETKESARLGLDAQ
    VNSVHWQDIVRRVFEKRIDPIAQGGEEYRRGEQTPNIDVYDQHARFVAERTLRTGQGEQAATISADQIVIAAGSRPFIPQ
    DIIDSKVTFHTNEDIMRLERQPESMVIVGGGYIAMEFAHVFDALGTKVTILSRSELLRHLDADLREPFNELAAARFDVRA
    GRTMASATEDEQGITLTLDDGSTVNAEVLLVATGRIPNGDQLDLDKAGIEAENGSISVDEFGRSTSAQGIWALGDISSPY
    MLKHVANAEMRAVRHNLLHPEDLKQMPHEHVPAAVFTHPQIANVGLTEGEAREAGHDITVKVQKYGDVAYGWAMEDSTGI
    AKLIADRQSGKLLGAHYMGPQASTLIQQMITVMAFGLDVREVATNQYWIHPALPEVTENALLGLDFS

    >gi|308177018|ref|YP_003916424.1| thiosulfate sulfurtransferase-like protein [Arthrobacter arilaitensis Re117]
    MNPLISASQLREALAAGQKPVLLDVRWVLGRDDGAQSYAAGHIPGAVFVDLEKELSSAPGEHTGRHPLPLPADFEAAARS
    WGINAESHVVVYDNSGALAAARAWWVLRHAGFDAVQVLDGGLAAWSDAGGELALGYQQPAAGTVSLSWGRMPVVEFDELD
    ALEGTLIDSRATARYLGIEEPVDPVAGHIPGALNRPTTDNLDAQMRFRNPEVLHDSFLKLDAQRSGSAAY
    CGSGITAAHQ
    VLAAASAGIELALYPGSWSEYCSYTDAPVATSDEKHRR

    >gi|308177137|ref|YP_003916543.1| putative peroxiredoxin [Arthrobacter arilaitensis Re117]
    MSTPEKTSRLTAGDQAPDFTLQDAAGNSVAPADYRGKKTIVYFYPAASTPGCTKQACDFRDSLESLQGLGYAVVGISPDK
    IAKLEKFVAKEELNFPLLSDEDHSVAEAYGAWGEKKNYGKVYEGLIRSTIVVDEEGKVALAQYNVRATGHVAKLRRDLGI
    DPK

    >gi|308177322|ref|YP_003916728.1| putative thiol-specific antioxidant protein [Arthrobacter arilaitensis Re117]
    MIQTGSRLFDFSLENQYGETITSTGLSSGRVLVVFYPWAFSRVCGSELATLQEHYEFFARHQVRIVAISVDHKFTLRNYA
    QSLGLDFELLADFWPHGAVAQQADAFDRDRGVAARLSLYLVDGEVRDIFRSEMTQPRSIDDYKAAVERGV

    >gi|308177352|ref|YP_003916758.1| peptide-methionine (S)-S-oxide reductase [Arthrobacter arilaitensis Re117]
    MQRRNVVNNVSILSLQSPHQFSPSLEVQGTKLTTFVLAGGCFWCLDAVYQRTRGVYAVISGYIGGHTADPQYREVCSGMT
    GHAEAVAVIFDAAVVPEEIILDMFFTVHDPTTLNRQGYDVGTQYRSAMFPLDDQQRELFEQSIQKFAGIYPNPIVTTMEE
    SKDFYPAEQIHQDYYSANQEVGYCRVIIDPKLVKVRKYYAQWLNEA

    >gi|308177451|ref|YP_003916857.1| putative iron-sulfur cluster assembly accessory protein [Arthrobacter arilaitensis Re117]
    MTASVEQTKGDPTEVPTHEVNISDVAAEKVRSLLEQEGRDDLRLRIAVQPGGCSGLIYQLYFDERMLEGDAVREFDGVEV
    IVDKMSVPYLAGASIDFEDTISKQGFTIDNPAASGSCACGDSFH

    >gi|308177553|ref|YP_003916959.1| glutaredoxin-like protein [Arthrobacter arilaitensis Re117]
    MSNELNLDQYVPAAGGVTMFTTSWCGYCRNLKRLMDQKGVAYTEVNIEEVEGTAEIVESFNNGNQTVPTLIFPDGTAATN
    PRIEEVVTRVGA

    >gi|308177558|ref|YP_003916964.1| putative oxidoreductase [Arthrobacter arilaitensis Re117]
    MEHFEAIVIGGGSAGLAAAVALGRSRRTVLVIDEGNPRNAKASHAHNILGQEGTNPMDLLERGRDEARHYGARIIEGKVD
    TLTGSLDTGFTVTMTERSYSAERIVLATGLIDNLPEIPGLAQAWGKSAIH
    CAYCHGWEVRNQELLVLGIGAMSSHQAMMF
    NQLSSKITFINHNSSALAEENRATLEALGIPVLEQSVIAVEFDDQGTLASVLLANNQRLNAETLVVATHMQAQAALYESL
    GGSLAENPLGTYISVNEMGATEVAGIYAAGNVCNLGAMVMAAAASGTIAGAAINADLISSQLATS

    >gi|308177567|ref|YP_003916973.1| glutaredoxin electron transport component NrdH [Arthrobacter arilaitensis Re117]
    MAITVYTKPSCVQCNATYRALDKKGVEYNKVDISQDAAALEHVRGLGYMQAPVVITDDDHWSGFRPDKIELLAPAN

    >gi|308177632|ref|YP_003917038.1| hypothetical protein AARI_18490 [Arthrobacter arilaitensis Re117]
    MAERQHVDFWFDPICPFAWATSRWIKEVEKVRDIDVTWNVMSLSMLNEGRDLPEDYRASMDSSWGPVRVIIKAAQEHGDE
    VKDSLYTAMGELFHYEKIEDRDEVVAKALEKVGLPAELAEAAHTDANDEALRASHEVGINKVGQDVGTPIVAVDGVAFFG
    PVITRVPTGEDAGKMFDAAAQLASFPYFFEMKRTRSESPVFD

    >gi|308177758|ref|YP_003917164.1| thiosulfate sulfurtransferase-like protein [Arthrobacter arilaitensis Re117]
    MSLPVESNEKYAAYAHPERLVSTQSVAENLGAENLVVLESDEDILLYSTGHVPGALKIDWHTELNDEVTRDYVDGEGFAK
    LMAAKGITRESTVVIYGDKSNWWAAYALWVFTLFGHEDVRLMDGGRDKWIAEGRELSTEKPAVTPTEYPVIERVDSKIRA
    FLPEVLNHLGNPLIDVRSAEEYTGERTHMPNYPEEGALRGGHIPTAASVPWAKAAAEDGTFRSREELEAIYLEGAGLKPG
    DDVVAY
    CRIGERSSHTWFVLKHLLGFETVRNYDGSWTEWGNAVGVPIVRGEAVGELPAKRGARA

    >gi|308177763|ref|YP_003917169.1| peptide-methionine (R)-S-oxide reductase [Arthrobacter arilaitensis Re117]
    MSNESVNQPVQPADNESERSDVQWQQILSAEEFHVLRQAGTERPFTGEYWDTTTEGVYACRACGAELFASTTKFDAGCGW
    PSFFAPLAEDRVRYISDVSMGMKRVEVRCASCDSHMGHVFEGEGFKTPTDLRY
    CMNSLSLTLRPAQG

    >gi|308177811|ref|YP_003917217.1| dihydrolipoyl dehydrogenase [Arthrobacter arilaitensis Re117]
    MADSAATQEFDVLILGGGSAGYSAALRAIQLGYTVGLIEKEKLGGTCLHTGCIPTKAYLHAAELAENAREGAKYGINSSL
    ESIDLAGVRKYKEGIVAGKYKGLQGLLKMKKVNVITGNGRLVSQDSIDVDGTVYKGKYIILATGSTSKTMGLEIGGRVLT
    STEALNMEDLPKSAIVLGGGVIGVEFASVWKSFGVDVTIVEGLPSLVPNEDPAIIKNLERAFKKRGIKFNTGVFFEKVEQ
    DANGAKVSLADGKVLEAEIVLVAVGRGPVTEGLGFEEQGITIDRGFVITNERLHTGVGNIYAIGDIVPGVQLAHRGYQHG
    RFVAEEIHGLKPTIVEDINIPKVTFCEPEIASVGYSEPKAKEKFGADQIETTEYNLAGNGKSSILGTSGIIKMVRVKNGP
    IVGVHGIGGRIGEQIGEAQLIVNWEAYPEDVSQLIHAHPTQNESIGEAAMALAGAPLHG

    >gi|308177969|ref|YP_003917375.1| adenylyltransferase ThiF [Arthrobacter arilaitensis Re117]
    MTRAPLVSAGAELEPAELARYSRHLTLPGVGAEGQRLIANAKVLVIGAGGLGSPIASYLIAAGVGTLGVVDDDRVELSNL
    QRQIMHREHDVGRLKVDSVPRLAHELNQHVRITTVAQKLDETNAVALFSDYDLVIDGSDNFATRYLSNDAAEITGTPLVW
    GTLFQFSGQVSVFDPRTGPMLRDLFPEIPDADSVPS
    CAEGGVFGALCGVIGSVMCTEALKLITGVGTTLSGKLWLYDALD
    ASVRTLSFSKDPKRDPVVELGQYQAAACGIEKQDLELSVGQLTEMEAQEAVLVVDVREGWEREIVAIPHSQHVPLAQLHE
    GELAELARSASKIVFV
    CKTGARSYQAAQNFASGPTSSIPVYSLSGGTLEWVKQVQGRDLAY

    >gi|308178188|ref|YP_003917594.1| thioredoxin [Arthrobacter arilaitensis Re117]
    MATKNVSEDEFAQLIDENDIVLVDFWAAWCGPCRNFAPVYEQTSEKFSDVVFAKVDTEAEQGLARAANVTSIPTIMAFRE
    NVLVFSQAGALNQTQLEDLVTAVKGIDMSEVHKQIAEEAAQADS

    >gi|308178246|ref|YP_003917652.1| redoxin domain-containing protein [Arthrobacter arilaitensis Re117]
    MTDPVPNPGPFSRRTMLRTLLVAAAVVPLAACSGKEDALTAQANSGDGKNYIAGDGAVEEYEVAKRSEPVTIKASTYHGT
    DIDFTQWQGKPVVMNFWYAA
    CAPCRIEAPDLKKIAEEFGEKVEFIGVNVRDEAEAAKAFERTFEIPYESIQDTDGNIQLA
    MTKYVPLQAVPSTLVLDRQGRVRARVIGAVEPSTLKSLINTALTEEL

    >gi|308178250|ref|YP_003917656.1| putative glutaredoxin [Arthrobacter arilaitensis Re117]
    MHQIQLLVREGCHLCQAARETVAEVTGRLHMEFSELDIDQDPQLLAKHHEEVPVLLIDGEVRDFWHIDAQRLERLLSS

    >gi|308178265|ref|YP_003917671.1| hypothetical protein AARI_24800 [Arthrobacter arilaitensis Re117]
    MAIHRIVLYYAFTPLPDPEAIRLWQRSLLERWGLRGRIIISKDGINGTVGGELSAVKAYVKATRELPAFKKMDIKWSEGS
    AEDFPRISVKVRDEIVTFGAPGELEVDENGVVGGGTHLRPEELHELVDTKEKSGEKVHFFDGRNAFEAQIGKFKDAIVPD
    VDTTRDFVAELDSGKYDHLKDQPVVTY
    CTGGIRCEVLSALMVKRGFQEVYQMQGGIVRYGEKYGDEGLWEGSLYVFDKRM
    HTEFSEDAVTIGECVGCQGPTNKFENCSNPECRNLRLFCEDCATDETLRRCPECSTVDA

    >gi|308178347|ref|YP_003917753.1| NHL repeat-containing protein [Arthrobacter arilaitensis Re117]
    MSATESVRANYKVRASELLGRNWLNTGGKQLDLEALRGKIVILDFWTFCCINCLHVLDELRPLEEQYKDVLVTVGVHSPK
    FEHEADPDALAAAVERYEIHHPVLDDPELVTWQAYGARAWPTLVVLDPEGYIVAHLSGEGHAQGLGSLIEELVAEHEAKG
    TLHRGNGPYVAPEAREGDLRFPGKAIALANGNFLVGDSGHHRLVELASDLSTVVRTIGAGVKGYADGDAQTAQFNELQGL
    TALPAELAAEVGYDVIVADTVNHRLRSVNLETGVVGTLAGNGVQRLLDSENARQEVQRTELGTDATNISLSSPWDVLYHP
    SGQVIIAMAGTHQIFAFNPRTSAVSVFAGTGLEGLADGAPDEAWFAQSSGLALDGQNVWIADSETSALRWIEVEEGKAQS
    VNTAVGTGLFDFGFRDGDAQQARLQHPLGVAVLPDHSIAIADSYNGAVRRFDPATKTVSTLAKGLKEPADVLVDTSVDGD
    PVLLVVETNTHQLVRIPIPAEALVVDEGASQTQRPKTPVRAGKHEILVRFAAPKGQKLDDRWGDPTQLKISASPEELILE
    GAGTSVGLTRTLELNPEIADGVLHITARAAACDGEPGGEIPDHAACHLYQQDWGIPVVLDAEGDNELLLDLRGVN

    >gi|308178568|ref|YP_003917974.1| OsmC-like protein [Arthrobacter arilaitensis Re117]
    MTNAASTLSISEDRAQRLQEAGHGWGKRISAAPQSAKLTFTVEGEGFDSVASNIVSGKHSFQVDEPAALGGNDVAASPVE
    YALGALIS
    CQVVVYRLYAQNLGIQVDDVKIVANGHLDVRGLFGIDKAIRPGFSSVDLDIQIAGPESAERYEELRQAVDAH
    CPVLDLFANPVPVRTAVSIAAAN

    >gi|308178801|ref|YP_003918207.1| glutaredoxin electron transport component NrdH [Arthrobacter arilaitensis Re117]
    MKTPVIVYSKPSCVQCNATYRALDKKGIPYEMIDISQDVEALEYVRSLGYTQAPVVVTDRDHWSGFRPDKIDVL

    >gi|308178863|ref|YP_003918269.1| metal binding protein [Arthrobacter arilaitensis Re117]
    MSHNCNCGCSSEKNSNQGLQIIPREQSSPLATRTELKISGMTCGHCVASVTEELKEIVGVQDVEVILDAKGVSTATVTSA
    SSLDEASIRSAIDEAGYTLEAINS

    >gi|308178864|ref|YP_003918270.1| cation-transporting ATPase [Arthrobacter arilaitensis Re117]
    MTSPAPHETRAEPRTVELDIQGMTCASCVNRVERKLGKLPGVSASVNLPLETAKVQVPADISDETLISTVAAAGYTASLK
    QPAKPAHADHAGPGEEDHGGHEHLVPENLLRRLIVSSVFTIPLFIISMIPGAQFPHWGWVAFALATPVVFYGAWPFHKAA
    AINARHFASTMDTLVSLGVLAAYLFSAIQLILDPQMTAHTGMSMSEHALYFETAGVVATLLLLGRFLEHRAKSSASDALK
    SLLSLGAKDAVVLRDGKEARIPAEQVQVGDHFVVRPGEKIATDGVVVDGASAVDTSLLTGESVPQKVGAGDEVTGATLNT
    SGRLVIEATRIGSDTTLAQMGKLVSEAQSGKAPIARLADRISAVFVPIVLAIAVLTFAIWFFTSGDTYQAFTAAVAVLVI
    ACPCALGLATPIGLLVGTGRGAQLGILIRGPQVLEDTRKLDTIVLDKTGTVTTGVMTHLGTEAIDGISPDEALMLAGAVE
    HHSEHPIAQAIAKAAAELGPLPQASGFDSDPGGGVLGMVNGHHVVVGRHSWLELQGTVLDATAMAMLEEAEQSGATAILV
    SVDQQFQAVISVADKIKDTSAKAIGELQDRGLRVVLLTGDNKSVATKVAAQVGIKAEDVFAGVFPADKAKAITALQEQGK
    VVAMVGDGVNDAPALAQADLGIAMGSGTDVAIEAADITLMGNDLHQVTQAIDLSAKTLSTIKMNLFWAFAYNTAGIPIAA
    LGLLNPMIAGAAMAASSVLVVLNSLRLRSFGK

    >gi|308178898|ref|YP_003918304.1| putative peroxiredoxin Bcp [Arthrobacter arilaitensis Re117]
    MSENSTVLAAGDQAPDFSLRNADGDTVSLADYAGKNVIVYFYPKAATPGCTIEACDFRDNINSLLGAGYSVLGISPDEPA
    EIAQFANDESLNFPLLSDPDSKVAKAYGSYGEKSKNGNTFVGTLRSTAVVAPDGTISQIEYGVEARGHVSRLRESLGV

    >gi|308179179|ref|YP_003918585.1| thioredoxin-disulfide reductase [Arthrobacter arilaitensis Re117]
    MISAQNEEIRDVIIVGSGPAGYTAAIYTARANLNPLVIAGSVTAGGELMNTTDVENFPGFPEGIMGPDLMDNMQKQAERF
    GAEILFDDVTEMNLEGEIKTLSLADGTVYRARSIIVSTGSAYRELGLEDEKRLSGHGVSW
    CATCDGFFFREQTIAVIGGG
    DSAMEEALFLTKFAAKVIVVHRRNELRASKIMADRALAHEKIEFIWDSEVIGINGADKVDGLVVKNRNSGEETTVNVTGI
    FVAIGNDPRVDLVKDQLELTAEGTIAVDGRTSKTSLPGVFAAGDVIDSTYRQAITAAGSGCAAAQDVEHYLANVSETLAT
    A

    >gi|308179180|ref|YP_003918586.1| thioredoxin [Arthrobacter arilaitensis Re117]
    MSNAKAVTEATFQAEVLDADKPVIVDFWAEWCGPCRQLGPILDQIAEEHAAKVDVVKVNVDENQAIAAKYGITSIPAVYV
    FKGGEHVATSIGAKPKAVIEKDFAEYL