Neisseria meningitidis FAM18 uid57825

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|121633920|ref|YP_974165.1| peptide methionine sulfoxide reductase [Neisseria meningitidis FAM18]
    MKHRTFFSLCAKFGCLLALGACSPKIVDAGAATVPHTLSTLKTADNRPASVYLKKDKPTLIKFWASWCPLCLSELGQTEK
    WAQDAKFSSANLITVASPGFLHEKKDGDFQKWYAGLNYPKLPVVTDNGGTIAQSLNISVYPSWALIGKDGDVQRIVKGSI
    NEAQALALIRDPNADLGSLKHSFYKPDTQKKDSKIMNTRTIYLAGG
    CFWGLEAYFQRIDGVVDAVSGYANGNTKNPSYED
    VSYRHTGHAETVKVTYDADKLSLDDILQYFFRVVDPTSLNKQGNDTGTQYRSGVYYTDPAEKAVIAAALKREQQKYQLPL
    VVENEPLKNFYDAEEYHQDYLIKNPNGYCHIDIRKADEPLPGKTKTAPQGKGFDAATYKKPSDAELKRTLTEEQYQVTQN
    SATEYAFSHEYDHLFKPGIYVDVVSGEPLFSSADKYDSGCGWPSFTRPIDAKSVTEHDDFSYNMRRTEVRSHAADSHLGH
    VFPDGPRDKGGLRY
    CINGASLKFIPLEQMDAAGYGALKSKVK

    >gi|121634147|ref|YP_974392.1| putative thiol:disulphide interchange protein [Neisseria meningitidis FAM18]
    MKSKHLALGVAALFALAACDSKVQTSVPADSAPAASAAAAPAGLVEGQNYTVLANPIPQQQAGKVEVLEFFGYFCPHCAH
    LEPVLSKHAKSFKDDMYLRTEHVVWQKEMLTLARLAAAVDMAAADSKDVANSHIFDAMVNQKIKLQEPEVLKKWLGEQTA
    FDGKKVLAAYESPESQARADKMQELTETFQIDGTPTVIVGGKYKVEFADWESGMNTIDLLADKVREEQKAAQ

    >gi|121634204|ref|YP_974449.1| hypothetical protein NMC0337 [Neisseria meningitidis FAM18]
    MDIVQLGSAELKAWMDEGRMFCLLDVRTDEETAVCSLPNALHIPMNLIPLRQNELPDDVPLVVYCHHGIRSLHTAMYLAD
    AGFENLYNLQGGIDAWAAEIDGNMMRY

    >gi|121634239|ref|YP_974484.1| putative periplasmic thioredoxin [Neisseria meningitidis FAM18]
    MRERMKKKLLSGIKFAVQTALVFLLVSLFLDWIRKPDEPAGAAGRPLTLLSGQRLTLGQFSRDKAVLVYFWGSWCGVCRY
    QSPIIDDLAADGVPVVGVAVRSGSSAEVAAYMAKRGLGFPTANDEDGGLARSWRIVATPAVVLVKNGKMVHYTTGISSYW
    GLRARIFQADVFG

    >gi|121634293|ref|YP_974538.1| putative glutaredoxin [Neisseria meningitidis FAM18]
    MQNFRKPNMQTVTMYTGPFCPYCAMAKRLLHAAGVGHIDEIRVDASPEAFAEMQQLSGQRSVPQIFIGETHVGGFTDLYR
    LQQEGGLDGLLNP

    >gi|121634345|ref|YP_974590.1| putative thiol:disulphide interchange protein [Neisseria meningitidis FAM18]
    MIQFRLSNTRNHLYMKTKLIKILTPFTVLPLLACGQTPVSNANAEPAVKAEPAVKAKSAGKSVAASLKARLEKTYSAQDL
    KVLSVNETPIKGIYEVVVSGKQIIYTDAKGDYMLVGDLINVNTRQSLTEERAADLNKIDFASLPLDKAIKEVRGNGKLKV
    AVFSDPD
    CPFCKRLEHEFEKMTDVTVYSFMMPIAGLHPDAARKAQILWCQPDRAKAWTDWMRKGKFPVGGSICDNPVAET
    TSLGEQFGFNGTPTLVFPNGRSQSGYSPMPQLEEIIRKNQ

    >gi|121634352|ref|YP_974597.1| iron-sulfur cluster insertion protein ErpA [Neisseria meningitidis FAM18]
    MSDESPIIFTDSCCAKVADLIAEENNPDLKLRVFVNGGGCSGFQYGFTFDEIKNDDDFEIEKNGLVFLVDPMSYQYLVGA
    EIDYTESLQGSQFVIRNPNAETTCGCGSSFSV

    >gi|121634360|ref|YP_974605.1| Na(+)-translocating NADH-quinone reductase subunit E [Neisseria meningitidis FAM18]
    MEHYLSLFIKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVIFVLGLSVPVNQLVYSLLKDGAIVEGVDLTFLKFI
    TFIGVIAALVQILEMFLDKFVPALYNALGIYLPLITVN
    CAIFGAVSFMAQREYNFGESVVYGFGAGLGWMLAIVALAGIT
    EKMKYSDAPKGLKGLGITFIAAGLMAMAFMSFSGIQL

    >gi|121634361|ref|YP_974606.1| Na(+)-translocating NADH-quinone reductase subunit D [Neisseria meningitidis FAM18]
    MADMKRLKHLMFSPFIDNNPIALQVLGICSALAVTTKLQTAIVMGISVALVTGFSSFFISLVRNYIPNSIRIIVQMAIIA
    SLVTLVDQLLQAFAYELSKQLSVFVGLIITN
    CIVMGRAEAFAMKEPPLESLIDGIGNGAGYGIMLLVVATVRELIGSGKL
    LGYTVFQTVQDGGWYQTNGLFLLAPSAFFIIGFLIWGLRTWKPEQAEE

    >gi|121634548|ref|YP_974793.1| hypothetical protein NMC0704 [Neisseria meningitidis FAM18]
    MAIAAVPLRAVLNNGNIGSRTMDVKYEFTLPSSSGADFHSAEHLPLVVYFYPKDSTPGCTTEGLDFNARLEQFEALGYTV
    VGISRDGVKAHQNFCAKQGFRFELLSDKDETVCRLFDVIKLKKLYGKESLGIERSTFVLNKDGEIAHEWRKVKVAGHAQE
    VLETLSR

    >gi|121634551|ref|YP_974796.1| putative thioredoxin [Neisseria meningitidis FAM18]
    MKLTLMFREYCSLCHKMRDALKPFQNEYGFGLEVVDVDENPVLEEKYNELVPVLLAGDEEICHWFLDEDRLKQFLER

    >gi|121634568|ref|YP_974813.1| hypothetical protein NMC0726 [Neisseria meningitidis FAM18]
    MASIHDQIKEVVTTHRVVLFMKGTKQFPQCGFSSRAVQILNAAGCTDYVTVNVLENPEVRQGIKEYSDWPTIPQLYVNGE
    FVGGSDILMEMYEAGELQELLKA

    >gi|121634578|ref|YP_974823.1| putative periplasmic protein [Neisseria meningitidis FAM18]
    MALGHRCRRFGTDKITSRPLRRQPQENPMNIKHLITAALIASAAFAAQAAPQKPLAAAQTAQHPAVWIDVRSEQEFSEGH
    LHNAVNIPVDQIVRRIHEAAPDKDTPVNLY
    CRSGRRAKAALQELKKAGYTNVANHGGYEDLLKKGMK

    >gi|121634748|ref|YP_974993.1| putative redoxin [Neisseria meningitidis FAM18]
    MALQDRTGQKVPSVVFRTRVGDTWKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYNELFGAFKENGVDAIYCVSVN
    DTFVMNAWAAEEESDNIYMIPDGNGEFTEGMGMLVGKEDLGFGKRSWRYSMLVNDGVVEKMFIEPEEPGDPFKVSDADTM
    LKFVAPDWKAQESVAIFTKPG
    CQFCAKAKQALQDKGLSYEEIVLGKDATVTSVRAITGKMTAPQVFIGGKYIGGSEDLEA
    YLAKN

    >gi|121634749|ref|YP_974994.1| dihydrolipoamide dehydrogenase [Neisseria meningitidis FAM18]
    MKKIQADVVVIGGGTAGMGAFRNARLHSDNVYLIENNVFGTTCARVGCMPSKLLIAAAEARHHALHTDPFGVHLDKDSIV
    VNGEEVMQRVKSERDRFVGFVVADVEEWPADKRIMGSAKFIDEHTVQIDEHTQITAKSFVIATGSRPVILPQWQSLGNRL
    IINDDVFSWDTLPKRVAVFGPGVIGLELGQALHRLGVKVEIFGLGGIIGGISDPVVSDEAKAVFGEELKLHLDAKTEVKL
    DADGNVEVHWEQDGEKGVFVAEYMLAAVGRRPNVDNIGLENINIEKDARGVPVADPLTMQTSIPHIFIAGDASNQLPLLH
    EAADQGKIAGDNAGRYPNIGGGLRRSTIGVVFTSPQIGFVGLKYAQVAAQYQADEFVIGEVSFKNQGRSRVMLVNKGHMR
    LYAEKATGRFIGAEIVGPAAEHLAHLLAWAHQMKMTVPQMLDMPFYHPVIEEGLRTALRDADAKLKA

    >gi|121634758|ref|YP_975003.1| dihydrolipoamide dehydrogenase [Neisseria meningitidis FAM18]
    MSQYDVVVIGAGPGGYVAAIRAAQLGFKTACVDAGVNKAGNAPALGGTCLNVGCIPSKALLQSSEHFHAAQHEFAEHGIT
    VGDVKFDVAKMIERKDAIVTKLTGGVKFLFQKNKVTSLFGTASFAGKNGDAYQIEVDNKGEKTVIEAKHVIVATGSVPRP
    LPQVAIDNVNVLDNEGALNLTEVPAKLGVIGSGVIGLEMGSVWNRVGAEVTILEAAPTFLAAADQQIAKEAFKYFTKEQG
    LSIELGVKIGDIKSEGKGVSVAYETAAGEAKTEVFDKLIVAIGRIPNTKGLNAEAVGLEKDERGFIKVDGECRTNLPNVW
    AIGDVVRGPMLAHKASDEGVAVAERIAGQKPHIDFNNVPFVIYTDPEIAWVGKTEEQLKAEGVEYKKGTSGFGANGRALA
    MGKAKGTVKVLADAKTDRILGVHMIGPVVSELVTEGVTALEFFASSEDIARIIHAHPTLSEVVHEAALAADKRALHG

    >gi|121634799|ref|YP_975044.1| hypothetical protein NMC0982 [Neisseria meningitidis FAM18]
    MPSEKCSDGISYNLLFAAHNQSVFPIPFRNAYHAPVPNICEQGKKMARLTVHTLETAPEAAKARVEAVLQNNGFIPNLIG
    VLSNAPEALAFYQEVGKLNAANSLTAGEVEVIQIIAARTNQCGF
    CVAGHTKLATLKKLLSEQSVKAARALAAGEFDDAKL
    GALAAFTQAVMAKKGAVSDDELKAFFDAGYNQQQAVEVVMGVALATLCNYVNNLGQTEINPELQAYA

    >gi|121634932|ref|YP_975177.1| hypothetical protein NMC1139 [Neisseria meningitidis FAM18]
    MIILHGIPNCDTVKKAKNRLAGYGLEFEFRDFKKQRPSEAEICSWLEQVPLATLLNKRGTSWRKLDAGTQQKVLSSTAEA
    VKLMSEMPSLIKRPVLECGGRVYVGFSEETYDGIFNRQALCRQG

    >gi|121634958|ref|YP_975203.1| putative P-type cation-transporting ATPase [Neisseria meningitidis FAM18]
    MCHRTKHRRNRNAMKKTCFHCGLDVPEHLHLTVRYENEDRETCCAGCQAVAQSIIDAGLGSYYKQRTADAQKTELPPQEI
    LDQIRLYDLPEVQSDFVETHGGTREAVLMLGGIT
    CAACVWLIEQQLLRTDGIVRIDLNYSTHRCRVVWDDGKIRLSDILL
    KIRQIGYTAAPYDAQKIEAANQKERKQYIVRLAVAGLGMMQTMMFALPTYLYGGDIEPDFLQILHWGGFLMVLPVVFYCA
    VPFYQGALRDLKNLRAGMDTPIAVAIIMTFIAGVYSLATNAGQGMYFESIAMLLFFLLGGRFMEHIARRKAGDAAERLVK
    LIPAFCHRMPGYPAVQDVREAAVVKLQAGDVVLVKPGETIPVDGTVLEGSSAVNESMLTGESLPVAKMPSEKVTAGTLNT
    QSPLIIRTDRTGGGTRLSHIVRLLDRALAQKPRTAELAEQYASSFIFGELLLAVPVFIGWTLYADAHTALWITVALLVIT
    CPCALSLATPTALAASTGTLAREGILIGGKQAIETLAQTTDIIFDKTGTLTQGKPAVRRISLLRGTDEAFVLAVAQALEQ
    QSEHPLARAILNCRISDGSVPDIAIKQRLNRIGEGVGAQLTVNGETQVWALGRASYVAEISGKEPQTEGGGSAVYLGSQS
    GFQAVFYLTDPLKDSAAEAVRQLAGKNLTLHILSGDRETAVAETARALGVAHYRAQAMPEDKLEYVKALQKEGKKVLMIG
    DGINDAPVLAQADVSAAAAGGTDIARDGADIVLLNEDLRTVAHLLDQARRTRHIIRQNLIWAGAYNIIAVPLAVLGYVQP
    WIAALGMSFSSLAVLGNALRLHKRGKMQSEKMPSEQ

    >gi|121635035|ref|YP_975280.1| thioredoxin reductase [Neisseria meningitidis FAM18]
    MSQHRKLIILGSGPAGYTAAVYAARANLNPVIITGIAQGGQLMTTTEVDNWPADADGVQGPELMARFLAHAERFGTEIIF
    DQINAVDLQKRPFTLKGDMGEYTCDALIVATGASAKYLGLPSEEAFAGKGVSA
    CATCDGFFYKNQDVAVVGGGNTAVEEA
    LYLANIAKTVTLIHRRSEFRAEKIMIDKLMKRVEEGKIILKLESNLQEVLGDDRGVNGALLKNNDGSEQQIAVSGIFIAI
    GHKPNTDIFKGQLEMDEAGYLKTKGGTADNVGATNIEGVWAAGDVKDHTYRQAITSAASGCQAALDAERWLGSQNI

    >gi|121635036|ref|YP_975281.1| putative cation-transporting ATPase [Neisseria meningitidis FAM18]
    MLGHCFSFAVSSFRILLELSARLRNFDHTGVQTASRSLNCRLNIKAGITLMQQKIRFQIEGMTCQACASRIEKVLNKKDF
    VESAGVNFASEEAQVVFDDSKTSVADIAKIIEKTGYGAKEKTEDTLPQAEAEHHIGWRLWLLSAINIPFLVGMAGMMIGR
    HDWMIPPLWQFALASIVQLWLAIPFYKSAWASIKGGLANMDVLVTIGTVSIYLYSVYMLFFSPHAAHGMAHVYFEAGVMV
    IGFVSLGKFLEHRTKKSSLNSLGLLLKLTPTQVNVQRDGEWKQLPIDQVQIGDLIRANHGERIAADGVIESGSGWADESH
    LTGESNPEEKKAGGKVLAGALMTEGSVVYRAAQLGSQTLLGDMMNALSEAQGSKAPIARVADKAAAVFVPAVVGIALLTF
    IVTWLIKGDWTVALMHAVAVLVIACPCALGLATPAAIMVGMGKAVKHGIWFKDAAAMEEAAHVDAVVLDKTGTLTEGRPQ
    VAAVYCVPDSGFDKDDLYRIAAAVEQNAAHPLARAIVSATQARGLEIPAAQNAQTVVGAGIAAEVEGAGLVKAGKAEFAE
    LTLPEFSDGVWDIASIVAVSVDNKPIGAFALADALKADTAEAIGRLKKHNIDVYIMSGDNQGTVEYVAQQLGIAHAFGNM
    SPRDKAAEVQKLKAAGKTVAMVGDGINDAPALAAANVSFAMKGGADVAEHTASATLMQHSVNQLADALLVSQATLKNIKQ
    NLFFAFFYNILGIPLAALGFLNPVIAGAAMAASSVSVLSNALRLKRVKID

    >gi|121635051|ref|YP_975296.1| dihydrolipoamide dehydrogenase (E3 component of pyruvate and 2-oxoglutarate dehydrogenase complexes) [Neisseria meningitidis FAM18]
    MSLVELKVPDIGGHENVDIIAVEVNVGDTIAVDDTLITLETDKATMDVPAEVAGVVKEVKVKVGDKISEGGLIVVVEAEG
    AAASPKAEAPVAAPAQEAPKAAAPAPQAAQFGGSADAEYDVVVLGGGPGGYSAAFAAADEGLKVAIVERYKTLGGV
    CLNV
    GCIPSKALLHNAAVIDEVRHLAANGIKYPEPELDIDMLRAYKNGVVSRLTGGLAGMAKGRKVDVIQGDGQFLDSHHLEVS
    LTAGDAYELAAPTGEKKIVAFKNCIIAAGSRVTKLPFIPEDPRIIDSSGALALKEVPGKLLIIGGGIIGLEMGTVYSTLG
    SRLDVVEMMDGLMQGADRDLVKVWQKQNEYRFDNIMVNTKTVAVEPKEDGVYVTFEGANAPKEPQRYDAVLVAAGRAPNG
    KLISAEKAGVAVTDRGFIEVDKQMRTNVPHIYAIGDIVGQPMLAHKAVHEGHVAAENCAGHKAYFDARVIPGVAYTSPEV
    AWVGETELSAKASGRKITKANFPWAASGRAIANGCDNGFTKLIFDAETGRIIGGGIVGPNGGDMIGEVCLAIEMGCDAAD
    IGKTIHPHPTLGESIGMAAEVALGTCTDLPPQKKK

    >gi|121635072|ref|YP_975317.1| thioredoxin I [Neisseria meningitidis FAM18]
    MSSELIVHTSDAAFEKDVLNADIPVLLDFWAPWCGPCKMIAPILDDIAAEFEGRLKVVKINIDDNEATPSRFGVRGIPTL
    MVFKNGEVVATKVGALAKGQLTAFVEASIA

    >gi|121635087|ref|YP_975332.1| HesB-like protein [Neisseria meningitidis FAM18]
    MITLTENAAKHINDYLAKRGKGLGVRLGVKTSGCSGMAYNLEFVDEADGDDLIFEGHGARIYIDPKSLVYLDGTQVDYTK
    EGLQEGFKFENPNVKDSCGCGESFHV

    >gi|121635190|ref|YP_975435.1| thiol:disulfide interchange protein precursor [Neisseria meningitidis FAM18]
    MQTNYLSETDSIMKKLICLFAVFLMLCGRAFALDANDLLPPEKAFVPELAVADDGVNVRFRIADGYYMYQAKIVGKTNPA
    DLLGQPSFSKGEEKEDEFFGRQTVYHHEAQVAFPYAKAVGEPYKLVLTYQGCAEVGVCYPPVDTEFDISGNGTYHPQTDE
    PASAKDRFLQPSSQNGSGALPPPKGDEGGDSRFKLSWDTLNANLLAFFLAGLGLSFTACMYPLLPIVSSIVVGDKKAGKA
    RAFVLSVVYVQGLALTYTLVGIVAGLTGALLTVWLQQAWVVLAASALMVVLALSMFGLFNIQLPNAVQSYFQNQSSRLSG
    GKIVSVFIMGILSALIVGPCVAPPLAFALGYIGQTGDAVLGGLALYTLALGTGVPLIAIGTFGGHILPKAGDWMNAVKYA
    FGFILLAVAVYLATPHLPYYLVVALYTLLMLVPACMLLVNGRRQKRRPKAVAFALGGILLIGGAWFGWQGANGKTTALHH
    FLTLNPPAEAGKSSEHGKMFADTAALKAAMDTALKEHPDKPVVLDFYADW
    CISCKEMAAYTLNQPEVHQAVDMERFFQID
    VTANKPEHQALLKEYGLFGPPGVFVVRSDGSRSEPLLGFVKADKFIEWYEQNR

    >gi|121635199|ref|YP_975444.1| putative methylated-DNA-protein-cysteine methyltransferase [Neisseria meningitidis FAM18]
    MPQPNPQDLRHSPFLHRRAGMTRIGDFAAKSMIEIRSKRMITLPSLNNLPSKWDEIRHCLETRVFECGVMPHPNLTECEA
    GQFDRDFWDNIGCAPEEYVRIRRAIRLLEVRYPDSLNELVCAAIATPLGEMLAVFGNKGLCLLEFVGQKHLEQEIAAVQK
    ALRGRFVFREDERTQLLRQELDLYFKGRLKTFATPLEQIGTEFQKQAWDALLAIPYGETRSYKEQAQRLGNPKAVRAVAA
    ANGQNKVSILIP
    CHRVIGSDGKLTGYAGGLNRKQFLLALERGEVQTALF

    >gi|121635221|ref|YP_975466.1| hypothetical protein NMC1483 [Neisseria meningitidis FAM18]
    MQVTSKWIDGMCFVGTTESGHSVVMEGSAAEGAAKRGPSPLEMLLLGVAGCSSIDVVMIAEKQRQKVTDCRATVTAKRAD
    DAPRVFTEIHIHFKVFGHDLKESAIERAVQMSAEKYCSASIMLGKAAKITHSFEIAGADK

    >gi|121635235|ref|YP_975480.1| putative lipoprotein [Neisseria meningitidis FAM18]
    MFSVPRSFLPGVFVLAALAACKPQDNSAAQVASSSASASAAENAAKPQTRGTDMRKEDIGGDFTLTDGEGKPFSLSDLKG
    KVVILSFGFTH
    CPDVCPTELLTYSDTLKQLGGQAKDVKVVFVSIDPERDTPEIIGKYAKQFNPDFIGLTATGDQNLPVIK
    QQYRVVSAKVNQKDDSENYLVDHSSGAYLIDKNGEVAIFSPYGSEPETIAADVRTLL

    >gi|121635248|ref|YP_975493.1| hypothetical protein NMC1512 [Neisseria meningitidis FAM18]
    MFKDWKEHTALVKKSFGELGKAHPKMLQAYGALEQAAAAEALDAKTRELIAIAVAITTRCESCISVHAAAAAKAGATDSE
    IAGALATAIALNAGAAYTYALRALEAVETQK

    >gi|121635273|ref|YP_975518.1| glutathione peroxidase [Neisseria meningitidis FAM18]
    MGIYDFQMKDAEGNAVDLSGYRGKVLLIVNTATRCGLTPQYEALQKLYAQYTAEGLEILDFPCNQFREQAPESSGEIAQV
    CMMKFGTKFKIFDKIEVNGANTAPLYAYLKSVKPQDKGNHLFKDFVLKLAALGEKRDEGDIKWNFTKFLVNRDGEVVERF
    APSVTPEEIEADIRALL

    >gi|121635289|ref|YP_975534.1| putative disulphide bond formation protein [Neisseria meningitidis FAM18]
    MPKFKSSGCIFLRALCGQIAVLSLVRSCVYRENRNRPHLRRCRFVPCHLGIYPAKSAYRYFDWCVEKMTPLFRKAVWLLF
    AVSVCAFAGSLAAQYVLGMEPCVLCISQRLCVLATALCTAIVLMCRPRRRAGGLFGAVFISIPAVTGISVAAYQLWLQSL
    PPGTAPS
    CGAPWTFRLKGWSLFDWFEPVVRGFGNCAEPDYLLGVALPVWSAAYFLAVVLTVWWAWARAK

    >gi|121635368|ref|YP_975613.1| glutaredoxin 2 [Neisseria meningitidis FAM18]
    MMKLYIYDHCPFCVRARMAAGLFGADVEEAVLANDDEATPIGMIGAKQVPVLQKEDGSFMGESLDIVRHFDREDRLKDEV
    RPEIRAWLDKVGGYNDKLVQPRVIKIGLPEFATPEAVKYFTDKKEKSIGSFSANLNKTAQYLERINADLQELENLMDGAS
    DGINGGIGMEDILVFPVLRNLTVVRGIEWPQKVMGYLMMMSEKSGVPLYFDRAL

    >gi|121635459|ref|YP_975704.1| putative thiol:disulphide interchange protein [Neisseria meningitidis FAM18]
    MKLKHLLPLLLSAVLSAQAYALTEGEDYLVLDKPIPQKQSGKIEVLEFFGYFCVHCHHFDPLLLKLGKALPSDAYLRTEH
    VVWQPEMLGLARMAAAVKLSGLKYQANPAVFKAVYEQKIRLENRSVAEKWALSQKGFDGKKLMRAYDSPAAAAAASKMQQ
    LTEQYRIDSTPTVVVGGKYRVIFNNGFDGGVHTIKELVAKVREERKRQTPAVQK

    >gi|121635572|ref|YP_975817.1| putative thiol:disulphide interchange protein [Neisseria meningitidis FAM18]
    MKLKTLALTSLTLLALAACSKQAETSVPADSVQSSSSAPAAPAPLTEGVNYTVLSTPIPQQQAGKVEVLEFFGYFCPHCA
    HLEPVLSEHIKTFKDDTYMRREHVVWGDEMKPLARLAAAVEMAGESDKANSHIFDAMVNQKINLADTDTLKKWLSEQTAF
    DGKKVLAAFEASESQARAAQMEELTNKFQISGTPTVIVGGKYQVEFKDWQSGMTTIDQLVDKVREEQKKPQ

    >gi|121635608|ref|YP_975853.1| putative regulator of pilE expression [Neisseria meningitidis FAM18]
    MMTLYSGITCPFSHRCRFVLYEKGMDFEIKDVDIYNKPEDLAVMNPYNQVPVLVERDLVLHESNIINEYIDERFPHPQLM
    PGDPVMRGRGRLVLYRMEKELFNHVQVLENPAATNKEQAKAREAIGNGLTMLAPSFSKSKYILGEDFSMIDVALAPLLWR
    LDHYDVKLGKSAAPLLKYAERIFQREAFIEALTPAEKAMRK

    >gi|121635613|ref|YP_975858.1| putative periplasmic protein [Neisseria meningitidis FAM18]
    MKKILTAAVVALIGILLAIVLIPDSKTAPAFSLPDLHGKTVSNADLQGKVTLINFWFPSCPGCVSEMPKIIKTANDYKNK
    NFQVLAVAQPIDPIESVRQYVKDYGLPFTVMYDADKAVGQAFGTQVYPTSVLIGKKGEILKTYVGEPDFGKLYQEIDTAL
    AQ

    >gi|121635720|ref|YP_975965.1| ThiF protein [Neisseria meningitidis FAM18]
    MQLHDFSLIAVNTVNVPQMPHPCQTVHTLTARVPKCRLKLNAARRQRYNRPQLFFPNIIMTTTEHDNDDAFLLRYSRHIL
    LDEIGIEGQQKLSAAHILVVGCGGLGAAALPYLAASGIGTLTIADSDTVELHNLQRQVAFDEGDVGKPKAEALADRLKRI
    NHNVDVRTVNEKLDGCRLTGLVQTADIVLDCCDNYATRQAVNRVCVQTKTPLVSGAAVRFEGQLAVYRPDLPDSPCYACL
    FDGGSASDGI
    CSLFGVFSPLVGIIGCTQAAEALKILLDVGEPSHGRLAVYRALEGGWQYFDLPRNPECPICGTER

    >gi|121635808|ref|YP_976053.1| putative oxidoreductase [Neisseria meningitidis FAM18]
    MPEIKIFHNPRCSKSRAALSLLEERGIAAEVVKYLDTPPDLSELKDIFNKLGLASARGMMRVKDDLYKELGLDNPDLDND
    ALLRAIAEHPALLERPIVLANGKAAVGRPLENIEAIL

    >gi|121635809|ref|YP_976054.1| putative periplasmic thiredoxin [Neisseria meningitidis FAM18]
    MKYLNLAAIALAATFAAHTASADELAGWKDGTAQSLQSLKAPVRIVNLWATWCGPCRKEMPAMSKWYKAQKKGSVDMVGI
    ALDTSDNIGNFLKQTPVSYPIWRYTGANSRNFMKTYGNTVGVLPFTVVEAPKCGYRQTITGEVNEKSLTEAVKLAHSKCR