Neisseria meningitidis alpha14

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|254804039|ref|YP_003082260.1| periplasmic thiredoxin [Neisseria meningitidis alpha14]
    MKYLNLAAITLAATFAAHTASADELAGWKDNTPQSLQSLKAPVRIVNLWATWCGPCRKEMPAMSKWYKAQKKGSVDMVGI
    ALDTSDNIGNFLKQTPVSYPIWRYTGANSRNFMKSYGNNIGVLPFTVVEAPKCGYRQTITGEANEKSLTEAVKLAHSKCR


    >gi|254804040|ref|YP_003082261.1| putative arsenate reductase [Neisseria meningitidis alpha14]
    MSEIKIFHNPRCSKSRAALSLLEERGIAAEVVKYLDTPPDLSELKDIFNKLGLASARGMMRVKDDLYKELGLDNPNLDND
    ALLRAIADHPALLERPIVLANGKAAVGRPLENIEAVL

    >gi|254804128|ref|YP_003082349.1| adenylyltransferase [Neisseria meningitidis alpha14]
    MQLHDFSLIAVNTVNVPQMPHPCQTVHTLTARVPKCRLKLNAARRQRYNRPQLFFPNIIMTTTEHDNDDAFLLRYSRHIL
    LDEIGIEGQQKLSAAHILVVGCGGLGAAALPYLAASGIGTLTIADSDTVELHNLQRQVAFDEGDVGKPKAEALADRLKRI
    NHNVDVRTVNEKLDGCRLTGLVQTADIVLDCCDNYATRQAVNRVCVQTKTPLVSGAAVRFEGQLAVYRPDLPDSPCYACL
    FDGGSASDGI
    CSLFGVFSPLVGIIGCTQAAEALKILLDVGEPSHGRLAVYRALEGGWQYFDLPRNPECPICGTER

    >gi|254804228|ref|YP_003082449.1| putative thioredoxin [Neisseria meningitidis alpha14]
    MPPENPRHAPYCADPDDYTAKRQNRRRSRHHPDARPRRHTTHRQPARHPCPRIGSLVRMKKILTAAVVALIGILLAIVLI
    PDSKTAPAFSLPDLHGKTVSNADLQGKVTLINFWFPS
    CPGCVSEMPKIIKTANDYKNKNFQVLAVAQPIDPIESVRQYVK
    DYGLPFTVMYDADKAVGQAFGTQVYPTSVLIGKKGEILKTYVGEPDFGKLYQEIDTALAQ

    >gi|254804232|ref|YP_003082453.1| stringent starvation protein A [Neisseria meningitidis alpha14]
    MMTLYSGITCPFSHRCRFVLYEKGMDFEIKDVDIYNKPEDLAVMNPYNQVPVLVERDLVLHESNIINEYIDERFPHPQLM
    PGDPVMRGRGRLVLYRMEKELFNHVQVLENPAATNKEQAKAREAIGNGLTMLAPSFSKSKYILGEDFSMIDVALAPLLWR
    LDHYDVKLGKSAAPLLKYAERIFQREAFIEALTPAEKAMRK

    >gi|254804294|ref|YP_003082515.1| Rhodanese-related sulfur transferase [Neisseria meningitidis alpha14]
    MDIVQLGPAELKAWMDEGRMFCLLDVRTDEETAVCSLPNALHIPMNLIPLRQNELPDDVPLVVYCHHGIRSLHTAMYLAD
    AGFENLYNLQGGIDAWAAEIDGNMMRY

    >gi|254804328|ref|YP_003082549.1| thioredoxin [Neisseria meningitidis alpha14]
    MKKKLLSGIKFAVQTALVFLLVSLFLDWVRKPEEPAGAAGRPLTLLSGQRLTLGQFSRDKAVLVYFWGSWCGVCRYQSPI
    IDDLAADGVPVVGVAVRSGSASEVAAYMAKRGLGFPTVNDEDGGLARSWRIVATPAVVLVKNGKMVHYTTGISSYWGLRA
    RIFQADVFG

    >gi|254804392|ref|YP_003082613.1| glutaredoxin [Neisseria meningitidis alpha14]
    MQTVTMYTGPFCPYCAMAKRLLHAAGVGHIDEIRVDASPEAFAEMQQLSGQRSVPQIFIGETHVGGFTDLYRLQQEGGLD
    GLLNP

    >gi|254804434|ref|YP_003082655.1| Protein-disulfide isomerase [Neisseria meningitidis alpha14]
    MKTKLIKILTPFTVLPLLACGQTPVSNANAEPAAKAESAGKSVAASLKARLEKTYSAQDLKVLSVSETPVKGIYEVVVSG
    RQIIYTDAEGGYMFVGELINIDTRKNLTEERAADLNKIDFASLPLDKAIKEVRGNGKLKVAVFSDPD
    CPFCKRLEHEFEK
    MTDVTVYSFMMPIAGLHPDAARKAQILWCQPDRAKAWTDWMRKGKFPVGGSICDNPVAETTSLGEQFGFNGTPTLVFPNG
    RSQSGYSPMPQLEEIIRKNQ

    >gi|254804439|ref|YP_003082660.1| hypothetical protein NMO_0439 [Neisseria meningitidis alpha14]
    MSDESPIIFTDSCCAKVADLIAEENNPDLKLRVFVNGGGCSGFQYGFTFDEIKNDDDFEIEKNGLVFLVDPMSYQYLVGA
    EIDYTENLQGSQFVIRNPNAETTCGCGSSFSV

    >gi|254804448|ref|YP_003082669.1| Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrE [Neisseria meningitidis alpha14]
    MEHYLSLFIKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVIFVLGLSVPVNQLVYSLLKDGAIVEGVDLTFLKFI
    TFIGVIAALVQILEMFLDKFVPALYNALGIYLPLITVN
    CAIFGAVSFMAQREYNFGESVVYGFGAGLGWMLAIVALAGIT
    EKMKYSDAPKGLKGLGITFIAAGLMAMAFMSFSGIQL

    >gi|254804449|ref|YP_003082670.1| Na(+)-translocating NADH-quinone reductase subunit D [Neisseria meningitidis alpha14]
    MADMKRLKHLMFSPFIDNNPIALQVLGICSALAVTTKLQTAIVMGISVALVTGFSSFFISLVRNYIPNSIRIIVQMAIIA
    SLVTLVDQLLQAFAYELSKQLSVFVGLIITN
    CIVMGRAEAFAMKEPPLESLIDGIGNGAGYGIMLLVVATVRELIGSGKL
    LGYTVFQTVQDGGWYQTNGLFLLAPSAFFIIGFLIWGLRTWKPEQAEE

    >gi|254804632|ref|YP_003082853.1| bacterioferritin comigratory protein [Neisseria meningitidis alpha14]
    MDVKYEFTLPSSSGADFHSAEHLPLVVYFYPKDSTPGCTTEGLDFNARLEQFEALGYTVVGISRDGVKAHQNFCAKQGFR
    FELLSDKDETVCRLFDVIKLKKLYGKESLGIERSTFVLNKDGEIAHEWRKVKVAGHAQEVLETLSR

    >gi|254804635|ref|YP_003082856.1| putative thioredoxin [Neisseria meningitidis alpha14]
    MKLTLMFREYCSLCHKMRDALKPFQNEYGFGLEVVDVDENPVLEEKYNELVPVLLAGDEEICHWFLDEDRLKQFLER

    >gi|254804652|ref|YP_003082873.1| Glutaredoxin-related protein [Neisseria meningitidis alpha14]
    MASIHDQIKEVVTTHRVVLFMKGTKQFPQCGFSSRAVQILNAAGCTDYVTVNVLENPEVRQGIKEYSDWPTIPQLYVNGE
    FVGGSDILMEMYEAGELQELLKA

    >gi|254804662|ref|YP_003082883.1| putative Rhodanese-related sulfurtransferase [Neisseria meningitidis alpha14]
    MNIKHLITTTLIASAAFAAQAAPQKPVSAAQTAQHPAVWIDVRSEQEFSEGHLHNAVNIPVDQIVRRIHEAAPDKDTPVN
    LY
    CRSGRRAKAALQELKKAGYTNVANHGGYEDLLKKGMK

    >gi|254804829|ref|YP_003083050.1| putative peroxiredoxin/glutaredoxin family protein [Neisseria meningitidis alpha14]
    MALQDRTGQKVPSVVFRTRVGDTWKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYNELFGAFKENGVDAIYCVSVN
    DTFVMNAWAAEEESDNIYMIPDGNGEFTEGMGMLVGKEDLGFGKRSWRYSMLVNDGVVEKMFIEPEELGDPFKVSDADTM
    LQFVAPDWKAQESVAIFTKPG
    CQFCAKAKQALQDKGLSYEEIVLGKDATVTSVRAITGKMTAPQVFIGGKYIGGSEDLEA
    YLAKN

    >gi|254804830|ref|YP_003083051.1| putative pyridine nucleotide-disulphide oxidoreductase [Neisseria meningitidis alpha14]
    MPSETDMFCVGNVSDENGRTKIMKKIQADVVVIGGGTAGMGAFRNARLHSDNVYLIENNVFGTTCARVGCMPSKLLIAAA
    EARHHALHTDPFGVHLDKDSIVVNGEEVMQRVKSERDRFVGFVVADVEEWPADKRIMGSAKFIDEHTVQIDEHTQITAKS
    FVIATGSRPVILPQWQSLGNRLIINDDVFSWDTLPKRVAVFGPGVIGLELGQALHRLGVKVEIFGLGGIIGGISDPVVSD
    EAKAVFGEELKLHLDAKTEVKLDADGNVEVHWEQDGEKGVFVAEYMLAAVGRRPNVDNIGLENINIEKDARGVPVADPLT
    MQTSIPHIFIAGDASNQLPLLHEAADQGKIAGDNAGRYPNIGGGLRRSTIGVVFTSPQIGFVGLKYAQVAAQYQADEFVI
    GEVSFKNQGRSRVMLVNKGHMRLYAEKATGRFIGAEIVGPAAEHLAHLLAWAHQMKMTVPQMLDMPFYHPVIEEGLRTAL
    RDADAKLKA

    >gi|254804839|ref|YP_003083060.1| 2-oxoglutarate dehydrogenase complex, E3 component [Neisseria meningitidis alpha14]
    MSQYDVVVIGAGPGGYVAAIRAAQLGFKTACVDAGVNKAGNAPALGGTCLNVGCIPSKALLQSSEHFHAAQHDFAEHGIT
    VGDVKFDAAKMIERKDAIVTKLTGGVKFLFQKNKVTSLFGTASFAGKNGDAYQIEVDNKGEKTVIEAKHVIVATGSVPRP
    LPQVAIDNVNVLDNEGALNLTEVPAKLGVIGSGVIGLEMGSVWNRVGAEVTILEAAPTFLAAADQQIAKEAFKYFTKEQG
    LNIELGVKIGDIKSEGKGVSVAYQTAAGEAKTEVFDKLIVAIGRIPNTKGLNAEDVGLEKDERGFIKVDGECRTNLPNVW
    AIGDVVRGPMLAHKASDEGVAVAERIAGQKPHIDFNNVPFVIYTDPEIAWVGKTEEQLKAEGVEYKKGTSGFGANGRALA
    MGKAKGTVKVLADAKTDRILGVHMIGPVVSELLTEGVTALEFFASSEDIARIIHAHPTLSEVVHEAALAADKRALHG

    >gi|254804884|ref|YP_003083105.1| hypothetical protein NMO_0904 [Neisseria meningitidis alpha14]
    MHATFYRAAIPNCPKQSKLPTPKPHWRNISGAGADKRVFFSIMPSEKCSDGISYNLSFAAHNQSVFPIPFRNAYHAPVPN
    ICEQGKKMARLTVHTLETAPEAAKARVEAVLQNNGFIPNLIGVLSNAPEALAFYQEVGKLNAANSLTAGEVEVIQIIAAR
    TNQCGF
    CVAGHTKLATLKKLLSEQSVKAARALAAGEFDDAKLGALAAFTQAVMAKKGAVSDEELKAFFDAGYNQQQAVEV
    VMGVALATLCNYVNNLGQTEINPELQAYA

    >gi|254805019|ref|YP_003083240.1| hypothetical protein NMO_1052 [Neisseria meningitidis alpha14]
    MIVLHGIPNCDTVKKAKNRLAGYGLEFEFRDFKKQVPSEAEICSWLEQVPLATLLNKRGTSWRKLDAETQQKALFSTAEA
    VKLMSEMPSLIKRPVLECGGKVYAGFSEETYDGIFNRQAPCRQG

    >gi|254805050|ref|YP_003083271.1| putative P-type cation transport ATPase [Neisseria meningitidis alpha14]
    MKKTCFHCGLDVPEHLHLTVRYENEDRETCCAGCQAVAQSIIDAGLGSYYKQRTADAQKTELPPQEILDQIRLYDLPEVQ
    SDFVETHGGTREAVLMLGGIT
    CAACVWLIEQQLLRTDGIVRIDLNYSTHRCRVVWDDGKIRLSDILLKIRQIGYTAAPYD
    AQKIEAANQKERKQYIVRLAVAGLGMMQTMMFALPTYLYGGDIEPDFLQILHWGGFLMVLPVVFYCAVPFYQGALRDLKN
    RRVGMDTPITVAIIMTFIAGVYSLATNAGQGMYFESIAMLLFFLLGGRFMEHIARRKAGDAAERLVKLIPAFCHHMPDYP
    DTQETCEAAVVKLKAGDIVLVKPGETIPVDGTVLEGSSAVNESMLTGESLPVAKMPSEKVTAGTLNTQSPLIIRTDRTGG
    GTRLSHIVRLLDRALAQKPRTAELAEQYASSFIFGELLLAVPVFIGWTLYADAHTALWITVALLVITCPCALSLATPTAL
    AASTGTLAREGILIGGKQAIETLAQTTDIIFDKTGTLTQGKPAVRRISLLRGTDEAFVLAVAQALEQQSEHPLARAILNC
    RISGGSVPDIAIKQRLNRIGEGVGAQLTVNGETQVWALGRASYVAEISGKEPQTEGGGSAVYLGSQSGFQAVFYLTDPLK
    DSAAEAVWQLAGKNLTLHILSGDRETAVAETARALGITHYRAQAMPEDKLEYVKALQKEGKKVLMIGDGINDAPVLAQAD
    VSAAAAGGTDIARDGADIVLLNEDLRTVAHLLDQARRTRQIIRQNLIWAGAYNIIAVPLAVLGYVQPWIAALGMSFSSLA
    VLGNALRLHKRGKMPSEKMPSEQ

    >gi|254805123|ref|YP_003083344.1| Thioredoxin reductase [Neisseria meningitidis alpha14]
    MSQHRKLIILGSGPAGYTAAVYAARANLNPVIITGIAQGGQLMTTTEVDNWPADADGVQGPELMARFLAHAERFGTEIIF
    DQINAVDLQKRPFTLKGDMGEYTCDALIVATGASAKYLGLPSEEAFAGKGVSA
    CATCDGFFYKNQDVAVVGGGNTAVEEA
    LYLANIAKTVTLIHRRSEFRAEKIMIDKLMKRVEEGKIILKLESNLQEVLGDDRGVNGALLKNNDGSEQQIAVSGIFIAI
    GHKPNTDIFKGQLEMDEAGYLKTKGGTADNVGATNIEGVWAAGDVKDHTYRQAITSAASGCQAALDAERWLGSQNI

    >gi|254805124|ref|YP_003083345.1| putative cation-transporting ATPase [Neisseria meningitidis alpha14]
    MQQKIRFQIEGMTCQACASRIEKVLNKKDFVESAGVNFASEEAQVVFDDSKTSVADIAKIIEKTGYGAKEKTEDTLPQPE
    AEHHIGWRLWLLFTINVPFLIGMVGMMLKGLNWTRHDWMLSPLLQFALASVVQLWLAIPFYKSAWASIRGGLANMDVLVT
    IGTVSIYLYSVYMLFFSPHAAHGMAHVYFEAGVMVIGFVSLGKFLEHRTKKSSLNSLGLLLKLTPTQVNVQRDGEWKQLP
    IDQVQIGDLIRANHGERIAADGVIESGSGWADESHLTGESNPEEKKAGGKVLAGALMTEGSVVYRAAQLGSQTLLGDMMN
    ALSEAQGSKAPIARVADKAAAVFVPAVVGIALLTFIVTWLIKGDWTVALMHAVAVLVIACPCALGLATPAAIMVGIGKAV
    KHGIWFKDAAAMEEAAHVDAVVLDKTGTLTEGRPQVAAVYCIPDSGFDEDALYRIAAAVEQNAAHPLARAIVSAAQARSL
    DIPTAQNAQTVVGSGIAAEVESVGLVKAGKAEFAELTLPKFLDGVWDIASIVAVSVDNKPIGAFALADALKADTAEAIGR
    LKKHNIDVYIMSGDNQGTVEYVAKQLGIAHAFGNMSPRDKAAEVQKLKAAGKTVAMVGDGINDAPALAAANVSFAMKGGA
    DVAEHTASATLMQHSVNQLADALSVSRATLRNIKQNLFFAFFYNILGIPLAALGFLNPVIAGAAMAASSVSVLSNALRLK
    RVKID

    >gi|254805138|ref|YP_003083359.1| putative dihydrolipoamide dehydrogenase [Neisseria meningitidis alpha14]
    MSLVELKVPDIGGHENVDIIAVEVNVGDTIAVDDTLITLETDKATMDVPAEVAGVVKEVKVKVGDKISEGGLIVVVEAEG
    TAAAPKAEAAAAPAQEAPKAAAPAPQAAQFGGSADAEYDVVVLGGGPGGYSAAFAAADEGLKVAIVERYKTLGGV
    CLNVG
    CIPSKALLHNAAVIDEVRHLAANGIKYPEPELDIDMLRAYKDGVVSRLTGGLAGMAKGRKVDIIQGDGQFLDPHHLEVSL
    TTSEVYEQATPTGEKKIVAFKNCIIAAGSRVTKLPFIPEDPRIFDSSGALALKEVPGKLLIIGGGIIGLEMGTVYSTLGS
    RLDVVEMMDGLMQGADRDLVKVWQKQNEYRFDNIMVNTKTVAVEPKEDGVYVTFEGANAPKEPQRYDAVLVAAGRAPNGK
    LISAEKAGVAVTDRGFIEVDKQMRTNVPHIYAIGDIVGQPMLAHKAVHEGHVAAENCAGHKAYFDARVIPGVAYTSPEVA
    WVGETELSAKASGRKITKANFPWAASGRAIANGCDNGFTKLIFDAETGRIIGGGIVGPNGGDMIGEVCLAIEMGCDAADI
    GKTIHPHPTLGESIGMAAEVALGTCTDLPPQKKK

    >gi|254805159|ref|YP_003083380.1| thioredoxin [Neisseria meningitidis alpha14]
    MSSELIVHTSDAAFEKDVLNADIPVLLDFWAPWCGPCKMIAPILDDIAAEFEGRLKVVKINIDDNEATPSRFGVRGIPTL
    MVFKNGEVVATKVGALAKGQLTTFVEASIA

    >gi|254805177|ref|YP_003083398.1| HesB/YadR/YfhF family protein [Neisseria meningitidis alpha14]
    MITLTENAAKHINDYLAKRGKGLGVRLGVKTSGCSGMAYNLEFVDEADGDDLIFEGHGARIYIDPKSLVYLDGTQVDYTK
    EGLQEGFKFENPNVKDSCGCGESFHV

    >gi|254805285|ref|YP_003083506.1| Thiol:disulfide interchange protein [Neisseria meningitidis alpha14]
    MQTNYLSETDSIMKKLICLFAVFLMLCGRAFALDANDLLPPEKAFVPELAVADDGVNVRFRIADGYYMYQAKIVGKTDPA
    DLLGQPSFSKGEEKEDEFFGRQTVYHHEAQVAFPYAKAVGEPYKLVLTYQGCAEAGVCYPPVDTEFDISGNGTYHPQTDE
    PASAKDRFLQPSSQNGSGALPPPKGDEGGDSRFKLSWDTLNANLLAFFLAGLGLSFTACMYPLLPIVSSIVVGDKKAGKA
    RAFVLSVVYVQGLALTYTLVGIVAGLTGALLTVWLQQAWVVLAASALMVVLALSMFGLFNIQLPNAVQSYFQNQSSRLSG
    GKIVSVFIMGILSALIVGPCVAPPLAFALGYIGQTGDAVLGGLALYTLALGTGVPLIAIGTFGGHILPKAGDWMNAVKYA
    FGFILLAVAVYLATPHLPYYLVVALYTLLMLVPAFMLLVNGRRQKRRPKAVAFALGGILLIGGAWFGWQGANGKTTALHH
    FLTLNPPAEAGKSSEHGKMFADTAALKAAMDTALKEHPDKPVVLDFYADW
    CISCKEMAAYTLNQPEVHQAVDMERFFQID
    VTANTPEHQALLKEYGLFGPPGVFVVRSDGSRSEPLLGFVKADKFIEWYEQNR

    >gi|254805294|ref|YP_003083515.1| Methylated DNA-protein cysteine methyltransferase [Neisseria meningitidis alpha14]
    MITLPSLNNLPSKWDEIRHCLETRVFECGVMPHPNLTECEAGQFDRDFWDNIGCAPEEYVRIRRAIRLLEARYPDSLNEL
    VCAAIATPLGEMLAVFGNKGLCLLEFVGQKHMEQEIAAVQKALRGRFVFREDERTQLLRQELDLYFKGRLKTFATPLEQI
    GTEFQKQAWDALLAIPYGETRSYKEQAQRLGNPKAVRAVAAANGQNKVSILIP
    CHRVIGSDGKLTGYAGGLNRKQFLLAL
    ERGEVQTALF

    >gi|254805347|ref|YP_003083568.1| putative SCO1/SenC family protein [Neisseria meningitidis alpha14]
    MFSVPRSFLPGVFVLAALAACKPQDNSAAQAASSSASASAAENAAKPQTRGTDMRKEDIGGDFTLTDGEGKPFSLSDLKG
    KVVILSFGFTH
    CPDVCPTELLTYSDTLKQLGGQAKDVKVVFVSIDPERDTPEIIGKYAKQFNPDFIGLTATGGQNLPVIK
    QQYRVVSAKVNQKDDSENYLVDHSSGAYLIDKNGEVAIFSPYGSEPETIAADVRTLL

    >gi|254805359|ref|YP_003083580.1| hypothetical protein NMO_1418 [Neisseria meningitidis alpha14]
    MFKDWKEHTALVKKSFGELGKAHPKMLQAYGALEQAAAAEALDAKTRELIAIAVAITTRCESCISVHAAAAAKAGATDSE
    IAGALATAIALNAGAAYTYALRALEAVETQK

    >gi|254805388|ref|YP_003083609.1| Glutathione peroxidase [Neisseria meningitidis alpha14]
    MGIYDFQMKDAEGNAVDLSGYRGKVLLIVNTATRCGLTPQYEALQKLYAQYTAEGLEILDFPCNQFREQAPESSGEIAQV
    CMMKFGTKFKIFDKIEVNGANTAPLYAYLKSVKPQDKGNHLFKDFVLKLAALGEKRDEGDIKWNFTKFLVNRDGEVVERF
    APSVTPEEIEADIRALL

    >gi|254805404|ref|YP_003083625.1| putative disulfide bond formation protein [Neisseria meningitidis alpha14]
    MTPLFRKAVWLLFAVSVCAFAGSLAAQYVLGMEPCVLCISQRLCVLATALCTAIVLMCRPRGRAGGLFGAVFISIPAVTG
    ISVAAYQLWLQSLPPGTAPS
    CGAPWTFRLKGWPLFDWFEPVVRGFGNCAEPDYLLGIALPVWSVAYFLAVVLTVWWAWAR
    AK

    >gi|254805482|ref|YP_003083703.1| Glutaredoxin 2 [Neisseria meningitidis alpha14]
    MKLYIYDHCPFCVRARMAAGLFGADVEEAVLANDDEATPIGMIGAKQVPVLQKEDGSFMGESLDIVRHFDREDRLKDEVR
    PEIRAWLDKVGGYNDKLVQPRVIKIGLPEFATPEAVKYFTDKKEKSIGSFSANLNKTAQYLERINADLQELENLMDGASD
    GINGGIGMEDILVFPVLRNLTVVRGIEWPQKVMGYLMTMSEKSGVPLYFDRAL

    >gi|254805561|ref|YP_003083782.1| thiol:disulfide interchange protein DsbA [Neisseria meningitidis alpha14]
    MKLKHLLPLLLSAVLSAQAYALTEGEDYLVLDKPIPQKQSGKIEVLEFFGYFCVHCHHFDPLLLKLGKALPSDAYLRTEH
    VVWQPEMLGLARMAAAVKLSGLKYQANPAVFKAVYEQKIRLENRSVAEKWALSQKGFDGKKLMRAYDSPAAAAAASKMQQ
    LTEQYRIDSTPTVVVGGKYRVIFNNGFDGGVHTIKELVAKVREERKRQTPAVQK

    >gi|254805665|ref|YP_003083886.1| putative thiol:disulfide interchange protein DsbA [Neisseria meningitidis alpha14]
    MKLKTLALTSLTLLALAACSKQAETSVPADSVQSSSSAPAAPAELNEGVNYTVLSTPIPQQQAGKIEVLEFFGYFCPHCA
    HLEPVLSEHIKTFKDDTYMRREHVVWGDEMKPLARLAAAVEMAGESDKANSHIFDAMVNQKINLADTDTLKKWLSEQTAF
    DGKKLLAAFEAPESQARAAQMEELTNKFQISGTPTVIVGGKYQVEFKDWQSGMTTIDQLVDKVREEQKKPQ

    >gi|254805681|ref|YP_003083902.1| thiol:disulfide interchange protein DsbA [Neisseria meningitidis alpha14]
    MKSRHLALGVAALFALAACDSKVQTSVPADSAPAASAAAAPAGLVEGQNYTVLANPIPQQQAGKVEVLEFFGYFCPHCAH
    LEPVLSKHAKSFKDDMYLRTEHVVWQKEMLTLARLAAAVDMAAAESKDVANSHIFDAMVNQKIKLQNPEVLKKWLGEQTA
    FDGKKVLAAYESPESQARADKMQELTETFQIDGTPTVIVGGKYKVEFADWESGMNTIDLLADKVREEQKAAQ

    >gi|254805878|ref|YP_003084099.1| Peptide methionine sulfoxide reductase [Neisseria meningitidis alpha14]
    MKHRTFFSLCAKFGCLLALGACSPKIVDAGAATVPHTLSTLKTADNRPASVYLKKDKPTLIKFWASWCPLCLSELGQTEK
    WAQDAKFSSANLITVASPGFLHEKKDGDFQKWYAGLNYPKLPVVTDNGGTIAQSLNISVYPSWALIGKDGDVQRIVKGSI
    NEAQALALIRDPNADLGSLKHSFYKPDTQKKDSKIMNTRTIYLAGG
    CFWGLEAYFQRIDGVVDAVSGYANGNTKNPSYED
    VSYRHTGHAETVKVTYDADKLSLDDILQYFFRVVDPTSLNKQGNDTGTQYRSGVYYTDPAEKAVIAAALKREQQKYQLPL
    VVENEPLKNFYDAEEYHQDYLIKNPNGYCHIDIRKADEPLPGKTKTAPQGKGFDAATYKKPSDAELKRTLTEEQYQVTQN
    SATEYAFSHEYDHLFKPGIYVDVVSGEPLFSSADKYDSGCGWPSFTRPIDAKSVTEHDDFSYNMRRTEVRSHAADSHLGH
    VFPDGPRDKGGLRY
    CINGASLKFIPLEQMDAAGYGALKSKVK

    >gi|254805319|ref|YP_003083540.1| putative OsmC-like stress-induced protein [Neisseria meningitidis alpha14]
    MQVTSKWIDGMCFVGTTEGGHSVVMEGSAVEGAVKRGPSPMEMLLLGVAGCSSIDVVMIAEKQRQKVTDCRATVTAKRAD
    DAPRVFTEIHIHFKVFGHDLKESAIERAVQMSAEKYCSASIMLGKAAKITHSFEIAGADK