Neisseria meningitidis 053442 uid58587

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|161869023|ref|YP_001598189.1| arsenate reductase [Neisseria meningitidis 053442]
    MPEIKIFHNPRCSKSRAALSLLEERGIAAEVVKYLDTPPDLSELKDIFNKLGLASARGMMRVKDDLYKELGLDNPNLDND
    ALLRAIADHPALLERPIVLANGKAAVGRPLENIEAVL

    >gi|161869024|ref|YP_001598190.1| thioredoxin-related transmembrane protein [Neisseria meningitidis 053442]
    MKYLNLAAITLAATFAAHTASADELAGWKDNTPQSLQSLKAPVRIVNLWATWCGPCRKEMPAMSKWYKAQKKGSVDMVGI
    ALDTSDNIGNFLKQTPVSYPIWRYTEANSRNFMKSYGNNVGVLPFTVVEAPKCGYKQTITGEVNEKSLTEAVKLAHSKCR


    >gi|161869062|ref|YP_001598228.1| trifunctional thioredoxin/methionine sulfoxide reductase A/B protein [Neisseria meningitidis 053442]
    MKHRTFFSLCAKFGCLLALGACSPKIVDAGAATVPHTLSTLKTADNRPASVYLKKDKPTLIKFWASWCPLCLSELGQTEK
    WAQDAKFSSANLITVASPGFLHEKKDGDFQKWYAGLNYPKLPVVTDNGGTIAQSLNISVYPSWALIGKDGDVQRIVKGSI
    NEAQALALIRDPNADLGSLKHSFYKPDTQKKDSKIMNTRTIYLAGG
    CFWGLEAYFQRIDGVVDAVSGYANGNTKNPSYED
    VSYRHTGHAETVKVTYDADKLSLDDILQYFFRVVDPTSLNKQGNDTGTQYRSGVYYTDPAEKAVIAAALKREQQKYQLPL
    VVENEPLKNFYDAEEYHQDYLIKNPNGYCHIDIRKADEPLPGKTKTAPQGKGFDAATYKKPSDAELKRTLTEEQYQVTQN
    SATEYAFSHEYDHLFKPGIYVDVVSGEPLFSSADKYDSGCGWPSFTRPIDAKSVTEHDDFSYNMRRTEVRSHAADSHLGH
    VFPDGPRDKGGLRY
    CINGASLKFIPLEQMDAAGYGALKSKVK

    >gi|161869131|ref|YP_001598296.1| 5-(beta-hydroxyethyl)thiazole monophosphate synthesis protein [Neisseria meningitidis 053442]
    MPHPCQTVHTLTARVPKCRLKLNAARRQRYNRPQLFFPNIIMTTTEHDNDDAFLLRYSRHILLDEIGIEGQQKLSAAHIL
    VVGCGGLGAAALPYLAASGIGTLTIADSDTVELHNLQRQVAFDEGDVGKPKAEALADRLKRINHNVDVRTVNEKLDGCRL
    TGLVQTADIVLDCCDNYATRQAVNRVCVQTKTPLVSGAAVRFEGQLAVYRPDLPDSPCYACLFDGGSASDGI
    CSLFGVFS
    PLVGIIGSTQAAEALKILLDAGEPSHGRLAVYRALEGGWQYFDLPRNPECPVCGTAR

    >gi|161869252|ref|YP_001598419.1| periplasmic protein [Neisseria meningitidis 053442]
    MKKILTAAVVALIGILLAIVLIPDSKTAPAFSLPDLHGKTVSNADLQGKVTLINFWFPSCPGCVSEMPKIIKTANDYKNK
    NFQVLAVAQPIDPIESVRQYVKDYGLPFTVMYDADKAVGQAFGTQVYPTSVLIGKKGEILKTYVGEPDFGKLYQEIDTAL
    AQ

    >gi|161869257|ref|YP_001598424.1| stringent starvation protein A [Neisseria meningitidis 053442]
    MMTLYSGITCPFSHRCRFVLYEKGMDFEIKDVDIYNKPEDLAVMNPYNQVPVLVERDLVLHESNIINEYIDERFPHPQLM
    PGDPVMRGRGRLVLYRMEKELFNHVQVLENPAATNKEQAKAREAIGNGLTMLAPSFSKSKYILGEDFSMIDVALAPLLWR
    LDHYDVKLGKSAAPLLKYAERIFQREAFIEALTPAEKAMRK

    >gi|161869331|ref|YP_001598498.1| hypothetical protein NMCC_0337 [Neisseria meningitidis 053442]
    MDIVQLGPAELKAWMDEGRMFCLLDVRTDEETAVCSLPNALHIPMNLIPLRQNELPDDVPLVVYCHHGIRSLHTAMYLAD
    AGFENLYNLQGGIDAWATEIDGNMMRY

    >gi|161869371|ref|YP_001598538.1| periplasmic thioredoxin [Neisseria meningitidis 053442]
    MKKKLLSGIKFAVQTALVFLLVSLFLDWIRKPDEPAGAAGRPLTLLSGQRLTLGQFSRDKAVLVYFWGSWCGVCRYQSPI
    IDDLAADGVPVVGVAVRSGSSAEVAAYMAKRGLGFPTANDEDGGLARSWRIVATPAVVLVKNGKMVHYTTGISSYWGLRA
    RIFQADVFG

    >gi|161869428|ref|YP_001598595.1| glutaredoxin 3 [Neisseria meningitidis 053442]
    MQNFRKPNMQTVTMYTGPFCPYCAMAKRLLHAAGVGHIDEIRVDASPEAFAEMQQLSGQRSVPQIFIGETHVGGFTDLYR
    LQQEGGLDGLLNP

    >gi|161869480|ref|YP_001598647.1| thiol:disulphide interchange protein [Neisseria meningitidis 053442]
    MIQFRFSNTRNHLYMKTKLIKILTPFTVLPLLACGQTPVSNANAEPAVKAESAGKSVAASLKARLEKTYSAQDLKVLSVS
    ETPVKGIYEVVVSGRQIIYTDAEGGYMFVGELINIDTRKNLTEERAADLNKIDFASLPLDKAIKEVRGNGKLKVAVFSDP
    D
    CPFCKRLEHEFEKMTDVTVYSFMMPIAGLHPDAARKAQILWCQPDRAKAWTDWMRKGKFPVGGSICDNPVAETTSLGEQ
    FGFNGTPTLVFPNGRSQSGYSPMPQLEEIIRKNQ

    >gi|161869490|ref|YP_001598657.1| hypothetical protein NMCC_0503 [Neisseria meningitidis 053442]
    MVRQDDLSLGLEIAGGQTYLLEQFLFQRRSLLAFKGGLRENAENIILRNNTMSDESPIIFTDSCCAKVADLIAEENNPDL
    KLRVFVNGGG
    CSGFQYGFTFDEIKNDDDFEIEKNGLVFLVDPMSYQYLVGAEIDYTESLQGSQFVIRNPNAETTCGCGSS
    FSV

    >gi|161869498|ref|YP_001598665.1| Na(+)-translocating NADH-quinone reductase subunit E [Neisseria meningitidis 053442]
    MEHYLSLFIKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVIFVLGLSVPVNQLVYSLLKDGAIVEGVDLTFLKFI
    TFIGVIAALVQILEMFLDKFVPALYNALGIYLPLITVN
    CAIFGAVSFMAQREYNFGESVVYGFGAGLGWMLAIVALAGIT
    EKMKYSDAPKGLKGLGITFIAAGLMAMAFMSFSGIQL

    >gi|161869499|ref|YP_001598666.1| Na(+)-translocating NADH-quinone reductase subunit D [Neisseria meningitidis 053442]
    MADMKRLKHLMFSPFIDNNPIALQVLGICSALAVTTKLQTAIVMGISVALVTGFSSFFISLVRNYIPNSIRIIVQMAIIA
    SLVTLVDQLLQAFAYELSKQLSVFVGLIITN
    CIVMGRAEAFAMKEPPLESLIDGIGNGAGYGIMLLVVATVRELIGSGKL
    LGYTVFQTVQDGGWYQTNGLFLLAPSAFFIIGFLIWGLRTWKPEQAEE

    >gi|161869694|ref|YP_001598861.1| bacterioferritin comigratory protein [Neisseria meningitidis 053442]
    MDVKYEFTLPSSSGADFHSAEHLPLVVYFYPKDSTPGCTTEGLDFNARLEQFEALGYTVVGISRDGVKAHQNFCAKQGFR
    FELLSDKDETVCRLFDVIKLKKLYGKESLGIERSTFVLNKDGEIAHEWRKVKVAGHAQEVLETLSR

    >gi|161869697|ref|YP_001598864.1| thioredoxin [Neisseria meningitidis 053442]
    MKLTLMFREYCSLCHKMRDALKPFQNEYGFGLEVVDVDENPVLEEKYNELVPVLLAGDEEICHWFLDEDRLKQFLER

    >gi|161869716|ref|YP_001598883.1| hypothetical protein NMCC_0736 [Neisseria meningitidis 053442]
    MASIHDQIKEVVTTHRVVLFMKGTKQFPQCGFSSRAVQILNAAGCTDYVTVNVLENPEVRQGIKEYSDWPTIPQLYVNGE
    FVGGSDILMEMYEAGELQELLKA

    >gi|161869730|ref|YP_001598897.1| putative phage shock protein E precursor [Neisseria meningitidis 053442]
    MNIKHLITAALIASAAFAAQAAPQKPVSAAQTAQHSAVWIDVRSEQEFSEGHLHNAVNIPVDQIVRRIHEAAPDKDTPVN
    LY
    CRSGRRAEAALQELKKAGYTNVANHGGYEDLLKKGMK

    >gi|161869858|ref|YP_001599027.1| peroxiredoxin 2 family protein/glutaredoxin [Neisseria meningitidis 053442]
    MALQDRTGQKVPSVVFRTRVGDTWKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYNELFGAFKENGVDAIYCVSVN
    DTFVMNAWAAEEESDNIYMIPDGNGEFTEGMGMLVGKEDLGFGKRSWRYSMLVNDGVVEKMFIEPEEPGDPFKVSDADTM
    LKFVAPDWKAQESVAIFTKPG
    CQFCAKAKQALQDKGLSYEEIVLGKDATVTSVRAITGKMTTPQVFIGGKYIGGSEDLEA
    YLAKN

    >gi|161869859|ref|YP_001599028.1| dihydrolipoamide dehydrogenase [Neisseria meningitidis 053442]
    MGAFRNARLHSNNVYLIENNVFGTTCARVGCMPSKLLIAAAEARHHALHTDPFGVHLDKDSIVVNGEEVMQRVKSERDRF
    VGFVVADVEEWPADKRIMGSAKFIDEHTVQIDEHTQITAKSFVIATGSRPVILPQWQSLGNRLIINDDVFSWDTLPKRVA
    VFGPGVIGLELGQALHRLGVKVEIFGLGGIIGGISDPVVSDEANAVFGEELKLHLDAKTEVKLDADGNVEVHWEQDGEKG
    VFVAEYMLAAVGRRPNVDNIGLENINIEKDARGVPVADPLTMQTSIPHIFIAGDASNQLPLLHEAADQGKIAGDNAGRYP
    NIGGGLRRSTIGVVFTSPQIGFVGLKYAQVAAQYQADEFVIGEVSFKNQGRSRVMLVNKGHMRLYAEKATGRFIGAEIVG
    PAAEHLAHLLAWAHQMKMTVPQMLDMPFYHPVIEEGLRTALRDADAKLKA

    >gi|161869869|ref|YP_001599038.1| dihydrolipoamide dehydrogenase [Neisseria meningitidis 053442]
    MSQYDVVVIGAGPGGYVAAIRAAQLGFKTACVDAGVNKAGNAPALGGTCLNVGCIPSKALLQSSEHFHAAQHDFAEHGIT
    VGDVKFDAAKMIERKDAIVTKLTGGVKFLFQKNKVTSLFGTASFAGKNGDAYQIEVDNKGEKTVIEAKHVIVATGSVPRP
    LPQVAIDNVNVLDNEGALNLTEVPAKLGVIGSGVIGLEMGSVWNRVGSEVTILEAAPTFLAAADQQIAKEAFKYFTKEQG
    LSIELGVKIGDIKSEGKGVSVAYETAAGEAKTEVFDKLIVAIGRIPNTKGLNAEAVGLEKDERGFIKVDGECRTNLPNVW
    AIGDVVRGPMLAHKASDEGVAVAERIAGQKPHIDFNNVPFVIYTDPEIAWVGKTEEQLKAEGVEYKKGTSGFGANGRALA
    MGKAKGTVKVLADAKTDRILGVHMIGPVVSELVTEGVTALEFFASSEDIARIIHAHPTLSEVVHEAALAADKRALHG

    >gi|161869906|ref|YP_001599075.1| macrophage infectivity potentiator-related protein [Neisseria meningitidis 053442]
    MPSEKCSDGISYNLLFAAHNQSVFPIPFRNAYHAPVPNICEQGKKMARLTVHTLETAPEAAKARVEAVLQNNGFIPNLIG
    VLSNAPEALAFYQEVGKLNAANSLTAGEVEVIQIIAARTNQCGF
    CVAGHTKLATLKKLLSEQSVKAARALAAGEFDDAKL
    GALAAFTQAVMAKKGAVSDEELKAFFDAGYNQQQAVEVVMGVALATLCNYVNNLGQTEINPELQAYA

    >gi|161870083|ref|YP_001599252.1| hypothetical protein NMCC_1121 [Neisseria meningitidis 053442]
    MIVLHGIPNCDTVKKAKNRLAGYGLEFEFRDFKKQRPSEAEISLWLEQVPLEILLNKRGTTWRKLNALMQEEALSSKEGA
    VRIMSEMPSLIKRPVLEYGGKVHVGFSDESYREIFKR

    >gi|161870114|ref|YP_001599284.1| P-type cation-transporting ATPase [Neisseria meningitidis 053442]
    MCHRTKHRRNRNAMKKTCFHCGLDVPENLHLTVRYENEDRETCCAGCQAVAQSIIDAGLGSYYKQRTADAQKTELPPQEI
    LDQIRLYDLPEVQSDFVETHGGTREAVLMLGGIT
    CAACVWLIEQQLLRTDGIVRIDLNYSTHRCRVVWDDGKIRLSDILL
    KIRQIGYTAAPYDAQKIEAANQKERKQYIVRLAVAGLGMMQTMMFALPTYLYGGDIEPDFLQILHWGGFLMVLPVVFYCA
    VPFYQGALRDLKNRRAGMDTPIAVAIIMTFIAGVYSLATNAGQGMYFESIAMLLFFLLGGRFMEHIARRKAGDAAERLVK
    LIPAFCHHMPDYPDTQETCEAAVVKLKAGDIVLVKPGETIPIDGTVLEGASTVDESMLTGESLPVAKMPSEKVTAGTLNT
    QNPLIIRTDRTGGGTRLSHIVRLLDRALAQKPRTAELAEQYASSFIFGELLLAVPVFIGWTLYADAHTALWITVALLVIT
    CPCALSLATPTALAASTGTLAREGILIGGKQAIETLAQTTDIIFDKTGTLTQGKPAVRRISLLRGTDEAFVLAVAQALEQ
    QSEHPLARAILNCRISDGSVPDIAIKQRLNRIGEGVGAQLTVNGETQVWALGRASYVAEISGKEPQTEGGGSAVYLGSQS
    GFQAVFYLTDPLKDSAAEAVRQLAGKNLTLHILSGDRETAVAETARALGVAHYRAQAMPEDKLEYVKALQKEGKKVLMIG
    DGINDAPVLAQADVSAAAAGGTDIARDGADIVLLNEDLNIVPHMFAQARRTQQIIRQNLIWAGAYNIIAVPLAVLGYVQP
    WIAALGMSFSSLAVLGNALRLHKRGKMPSEKMPSEQCRTALL

    >gi|161870199|ref|YP_001599369.1| thioredoxin reductase [Neisseria meningitidis 053442]
    MTTTEVDNWPADADGVQGPELMARFLAHAERFGTEIIFDQINAVDLQKRPFTLKGDMGEYTCDALIVATGASAKYLGLPS
    EEAFAGKGVSA
    CATCDGFFYKNQDVAVVGGGNTAVEEALYLANIAKTVTLIHRRSEFRAEKIMIDKLMKRVEEGKIILKL
    ESNLQEVLGDDRGVNGALLKNNDGSEQQIAVSGIFIAIGHKPNTDIFKGQLEMDEAGYLKTKGGTADNVGATNIEGVWAA
    GDVKDHTYRQAITSAASGCQAALDAERWLGSQNI

    >gi|161870200|ref|YP_001599370.1| cation transporter E1-E2 family ATPase [Neisseria meningitidis 053442]
    MLGHCSSFAVSSFRILLELSARLRNFDHTGVQTASRNLDCRLNIKAGIKLMQQKIRFQIEGMTCQSCASRIEKVLNKKDF
    VESAGVNFASEEAQVTFDDSKTSAADIAKIIEKTGYGAKEKTEDTLPQPEAEHHIGWRLWLLLAINIPFLIGMAGMMIGR
    HDWMIPPLWQFALASIVQLWLAIPFYKSAWASIKGGLANMDVLVTIGTVSIYLYSVYMLFFSPHAAHGMAHVYFEVGVMV
    IGFVSLGKFLEHRTKKSSLNSLGLLLKLTPTQVNVQRNGEWKQLPIDQVQIGDLIRANHGERIAADGIIESGSGWADESH
    LTGESNPEEKKAGGKVLAGALMTEGSVVYRATQLGSQTLLGDMMNALSEAQGSKAPIARVADKAAAVFVPTVVGIALLTF
    ITTWLVKGDWTVALMHAVAVLVIACPCALGLATPAAIMVGMGKAVKHGIWFKDAAAMEEAAHVDAVVLDKTGTLTEGRPQ
    VAAVYCVPDSGFDEDALYRIAAAVEQNAAHPLARAIVSAAQARGLGIPAAQNAQTVVGAGIAAEVESVGLVKAGKAEFAE
    LTLPKFSDGVWDIASIVAVSVDNKPIGAFALADALKADTAEAIGRLKKHNIDVYIMSGDNQGTVEYVAKQLGIAHAFGNM
    SPRDKAAEVQKLKAAGKTVAMVGDGINDAPALAAANVSFAMKGGADVAEHTASATLMQHSVNQLADALLVSQATLKNIKQ
    NLFFAFFYNILGIPLAALGFLNPIIAGAAMAASSVSVLGNALRLKRVKID

    >gi|161870216|ref|YP_001599386.1| dihydrolipoamide dehydrogenase (E3 component of pyruvate and 2-oxoglutarate dehydrogenase complexes) [Neisseria meningitidis 053442]
    MSLVELKVPDIGGHENVDIIAVEVNVGDTIAVDDTLITLETDKATMDVPAEVAGVVKEVKVKVGDKISEGGLIVVVEAEG
    TAAAPKAEAAAASAQEAPKAAAPAPQAAQFGGSADAEYDVVVLGGGPGGYSAAFAAADKGLKVAIVERYKTLGGV
    CLNVG
    CIPSKALLHNAAVIDEVRHLAANGIKYPEPELDIDMLRAYKDGVVSRLTGGLAGMAKGRKVDVIQGDGQFLDSHHLEVSL
    TAGDAYELAAPTGEKKIVAFKNCIIAAGSRVTKLPFIPEDPRIIDSSGALALKEVPGKLLIIGGGIIGLEMGTVYSTLGS
    RLDVVEMMDGLMQGADRDLVKVWQKQNEYRFDNIMINTKTVAVEPKEDGVYVTFEGANAPKEPQRYDAVLVAAGRAPNGK
    LISAEKAGVAVTDRGFIEVDKQMRTNVPHIYAIGDIVGQPMLAHKAVHEGHVAAENCAGHKAYFDARVIPGVAYTSPEVA
    WVGETELSAKASGRKITKANFPWAASGRAIANGCDNGFTKLIFDAETGRIIGGGIVGPNGGDMIGEVCLAIEMGCDAADI
    GKTIHPHPTLGESIGMAAEVALGTCTDLPAQKKK

    >gi|161870236|ref|YP_001599406.1| thioredoxin I [Neisseria meningitidis 053442]
    MSSELIVHTGDAAFEQDVLKSDLPVLLDFWAPWCGPCKMIAPILDDIAAEFEGRLKVVKINIDDNEATPSRFGVRGIPTL
    MVFKNGDVVATKVGALAKGQLTAFVEASIA

    >gi|161870255|ref|YP_001599425.1| HesB/YadR/YfhF family protein [Neisseria meningitidis 053442]
    MPSEPPAASGLSGAIQQGRNMITLTENAAKHINDYLAKRGKGLGVRLGVKTSGCSGMAYNLEFVDEADGDDLIFEGHGAR
    IYIDPKSLVYLDGTQVDYTKEGLQEGFKFENPNVKDSCGCGESFHV

    >gi|161870379|ref|YP_001599551.1| thiol:disulfide interchange protein precursor [Neisseria meningitidis 053442]
    MQTNYLSETDSIMKKLICLFAVFLMLCGRAFALDANDLLPPEKAFVPELAVADDGVNVRFRIADGYYMYQAKIVGKTDPA
    DLLGQPSFSKGEEKEDEFFGRQTVYHHEAQVAFPYAKAVGEPYKLVLTYQGCAEAGVCYPPVDTEFDISGNGTYHPQTDE
    PASAKDRFLQPSSQNGSGVLPPPKGDEGGDSRFKLSWDTLNANLLAFFLAGLGLSFTACMYPLLPIVSSIVVGDKKAGKA
    RAFVLSVVYVQGLALTYTLVGIVAGLTGALLTVWLQQAWVVLAASALMVVLALSMFGLFNIQLPNAVQSYFQNQSSRLSG
    GKIVSVFIMGILSALIVGPCVAPPLAFALGYIGQTGDAVLGGLALYTLALGTGVPLIAIGTFGGHILPKAGDWMNAVKYA
    FGFILLAVAVYLATPHLPYYLVVALYTLLMLVPACMLLVNGRRQKRRPKAVAFVLGGILLIGGAWFGWQGANGKTTALHH
    FLTLNPPAEAGKSSEHGKMFADTAALKAAMDTALKEHPDKPVVLDFYADW
    CISCKEMAAYTLNQPEVHQAVDMERFFQID
    VTANMPEHQALLKEYGLFGPPGVFVVRSDGSRSEPLLGFVKADKFIEWYEQNR

    >gi|161870389|ref|YP_001599561.1| methylated-DNA-protein-cysteinemethyltransferase [Neisseria meningitidis 053442]
    MITLPSLNNLPSKWDEIRYWLETRVCECGVMPHPNLTECEAGQFDRDFWDNIGCAPEEYVRIRRAIRLLEARYPDSLNEL
    VCAAIATPLGEMLAVFGNKGLCLLEFVGQKHLEQEIAAVQKALRGRFVFREDERTQLLRQELDLYFKGRLKTFATPLEQI
    GTEFQKQAWDALLAIPYGETRSYKEQAQRLGNPNAVRAVAAANGQNKVSILIP
    CHRVIGSDGKLTGYAGGLNRKQFLLAL
    ERGEVQTALF

    >gi|161870419|ref|YP_001599591.1| hypothetical protein NMCC_1467 [Neisseria meningitidis 053442]
    MQVTSKWIDGMCFVGTTEGGHSVVMEGSAAEGKAKRGPSPLEMLLLGVAGCSSIDVVMIAEKQRQKVTDCRATVTAKRAD
    DAPRVFTEIHIHFKVFGHDLKESAIERAVQMSAEKYCSASIMLGKAAKITHSFEIAGADK

    >gi|161870433|ref|YP_001599605.1| lipoprotein [Neisseria meningitidis 053442]
    MFSVPRSFLPGVFVLAALAACKPQDNSAAQAASSSASASAAENAAKPQTRGTDMRKEDIGGDFTLTDGEGKPFSLSDLKG
    KVVILSFGFTH
    CPDVCPTELLTYSDTLKQLGGQAKDVKVVFVSIDPERDTPEIIGKYAKQFNPDFIGLTATGDQNLPVIK
    QQYRVVSAKVNQKDDSENYLVDHSSGAYLIDKNGEVAIFSPYGSEPETIAADVRTLL

    >gi|161870445|ref|YP_001599617.1| hypothetical protein NMCC_1500 [Neisseria meningitidis 053442]
    MFKDWKEHTALVKKSFGELGKAHPKMLQAYGALEQAAAAEALDAKTRELIAIAVAITTRCESCISVHAAAAAKAGATDSE
    IAGALATAIALNAGAAYTYALRALEAVETQK

    >gi|161870474|ref|YP_001599646.1| glutathione peroxidase [Neisseria meningitidis 053442]
    MLLSCRLKHVSDGIGLHQIRIKMGIYDFQMKDAEGNAVDLSGYRGKVLLIVNTATRCGLTPQYEALQKLYAQYTAEGLEI
    LDFPCNQFREQAPESSGEIAQVCMMKFGTKFKIFDKIEVNGANTAPLYAYLKSVKPQDKGNHLFKDFVLKLAALGEKRDE
    GDIKWNFTKFLVNRDGEVVERFAPSVTPEEIEADIRALL

    >gi|161870493|ref|YP_001599665.1| disulfide bond formation protein DsbB [Neisseria meningitidis 053442]
    MPKFKSSGCIFLRALCGQIAVLSLVRSCVYRENRNRPHLSRCRFVPCHLGIYPAKSAYRYFDWCVEKMTPLFRKAVWLLF
    AVSVCAFAGSLAAQYVLGMEPCVLCISQRLCVLATALCTAIVLMCRPRRRAGGLFGAVFISIPAVTGISVAAYQLWLQSL
    PPGTAPS
    CGAPWTFRLKGWPLFDWFEPVVRGFGNCAEPDYLLGVALPVWSAAYFLAVVLTVWWAWARAK

    >gi|161870581|ref|YP_001599753.1| glutaredoxin 2 [Neisseria meningitidis 053442]
    MARGVKVAGTDRLTRNILMKLYIYDHCPFCVRARMAAGLFGADVEEAVLANDDEATPIGMIGAKQVPVLQKEDGSFMGES
    LDIVRHFDREDRLKDEVRPEIRAWLDKVGGYNDKLVQPRVIKIGLPEFATPEAVKYFTDKKEKSIGSFSANLNKTAQYLE
    RINADLQELENLMDGASDGINGGIGMEDILVFPVLRNLTVVRGIEWPQKVMGYLMTMSEKSGVPLYFDRAL

    >gi|161870667|ref|YP_001599840.1| thiol:disulfide interchange protein DsbA [Neisseria meningitidis 053442]
    MKLKHLLPLLLSAVLSAQAYALTEREDYLVLDKPIPQEQSGKIEVLEFFGYFCVHCHHFDPLLLKLGKALPSDAYLRTEH
    VVWQPEMLGLARMAAAVNLSGLKYQANPAVFKAVYEQKVHLEDRAVAGKWALSQKGFDGKKLMRVYDSPEAAAAASKMQK
    LTEQYGIDNTPTVIVGGKYRVIFNNGFDGGVHTIKELVAKVREERKRQPPAVQK

    >gi|161870770|ref|YP_001599943.1| thiol:disulphide interchange protein DsbA [Neisseria meningitidis 053442]
    MKLKTLALTSLTLLALAACSKQAETSVPADSAQSNTSAPATPAALTEGINYTVLSNPIPQQQAGKIEVLEFFGYFCPHCA
    HLEPVLSEHIKTFKDDTYMRREHVVWGDEMKPLARLAAAVEMAGESDKANSHIFDAMVNQKINLADTDTLKKWLSEQTAF
    DGKKVLAAFEAPESQARAAQMEELTNKFQISGTPTVIVGGKYQVEFKDWQSGMTTIDQLVDKVREEQKKPQ

    >gi|161870785|ref|YP_001599958.1| thiol:disulfide interchange protein DsbA [Neisseria meningitidis 053442]
    MKSRHLALGVAALFALAACDSKVQTSVPADSAPAASAAAAPAGLVEGQNYTVLANPIPQQQAGKVEVLEFFGYFCPHCAH
    LEPVLSKHAKSFKDDMYLRIEHVVWQKEMLPLARLAAAVDMAAADSKDVANSHIFDAMVNQKIKPQNPEVLKKWLGEQTA
    FDGKKVLAAYESPESQARADKMQELTETFQIDGTPTVIVGGKYKVEFADWESGMNTIDLLADKVREEQKAAQ