Neisseria gonorrhoeae NCCP11945 uid59191

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|194097616|ref|YP_002000652.1| hypothetical protein NGK_0027 [Neisseria gonorrhoeae NCCP11945]
    MGLQTAFCLVFFGGFVMDIVQLPSAALKAWMDEGRMFCLLDVRTDEEAAVCSLPNALHIPMNLIPLRQNELPDDVPLVVY
    CHHGIRSLHTAMYLAEAGFENLYNLQGGIDAWAVEVDAEMARY

    >gi|194097665|ref|YP_002000705.1| putative thioredoxin [Neisseria gonorrhoeae NCCP11945]
    MKKKLLSGIKFAVRTALVFLLVSLFLDWVRKPDEPAGAAGRPLTLLSGQRLTLGQFSRDRTVLVYFWGSWCGVCRYQSPI
    IDDLAADGVPVVGVAVRSGSASEVAAYMAKRGLGFPTVSDEDGGLARSWRIAATPAVVLVKNGKMVRYTTGISSYWGLRA
    RIFQADFFG

    >gi|194097744|ref|YP_002000785.1| putative glutaredoxin [Neisseria gonorrhoeae NCCP11945]
    MQNFRKPNMQTVTMYTGPFCPYCAMAKRLLHAAGVGHIDEIRVDASPEAFAEMQRLSGQRSVPQIFIGETHVGGFTDLYR
    LQQEGGLDGLLNP

    >gi|194097837|ref|YP_002000882.1| hypothetical protein NGK_0257 [Neisseria gonorrhoeae NCCP11945]
    MFKDWKEHTALVKKSFGELGKAHPKMLQAYGALEQAAAAEALDAKTRELIAIAVAITTRCESCISVHAAAAAKAGATDSE
    IAGALATAIALNAGAAYTYALRALEAVETQK

    >gi|194097850|ref|YP_002000895.1| Lipoprotein [Neisseria gonorrhoeae NCCP11945]
    MFSVPRSFLPGVFVLAALAACKPQDNSAAQAASSSASAPAAENAAKPQTRGTDMRKEDIGGDFTLTDGEGKPFSLSDLKG
    KVVILSFGFTH
    CPDVCPTELLTYSDTLKQLGGQAKDVKVVFVSIDPERDTPEIIGKYAKQFNPDFIGLTATGGQNLPVIK
    QQYRVVSAKINQKDDSENYLVDHSSGAYLIDKNGEVAIFSPYGSEPETIAADVRTLL

    >gi|194097868|ref|YP_002000913.1| hypothetical protein NGK_0288 [Neisseria gonorrhoeae NCCP11945]
    MQSGFNAIFGNDTMQVTSKWIDGMCFVGTAEGGHSVVMEGSAAEGAAKRGPSPLEMLLLGVAGCSSIDVVMIAEKQRQKV
    TDCRATVTAKRADDAPRVFTEIHIHFKVIGHDLKESAIERAVQMSAEKYCSASIMLGKAAKITHSFEIAGAEK

    >gi|194098058|ref|YP_002001106.1| Bacterioferritin comigratory protein [Neisseria gonorrhoeae NCCP11945]
    MDMKYEFTLPSSSGADFHSAEHLPLVVYFYPKDSTPGCTTEGLDFNARLEQFEALGYTVVGISRDGVKAHQNFCAKQGFR
    FELLSDKDETVCRLFDVIKLKKLYGKESLGIERSTFVLNKDGEIVREWRKVKVAGHAQEVLETLSR

    >gi|194098062|ref|YP_002001110.1| Thioredoxin [Neisseria gonorrhoeae NCCP11945]
    MCKLTDKETRMKLTLMFREYCSLCHKMRDALKPFQDEYGFGLEVVDVDENPVLEEKYNELIPVLLAGDEEICHWFLDEDR
    LKQFLER

    >gi|194098085|ref|YP_002001133.1| GrlA [Neisseria gonorrhoeae NCCP11945]
    MASIHDQIKEVVTTHRVVLFMKGTKQFPQCGFSSRAVQILNAAGCTDYVAVNVLENPEVRQGIKEYSDWPTIPQLYVNGE
    FVGGSDILMEMYEAGELQELLKA

    >gi|194098104|ref|YP_002001152.1| Putative periplasmic protein [Neisseria gonorrhoeae NCCP11945]
    MNIKQLITAALIASAAFATQAAPQKPVSAAQTAQHSAVWIDVRSEQEFSEGHLHNAVNIPVDQIVRRIYEAAPDKDTPVN
    LY
    CRSGRRAEAALQELKKAGYTNVANHGGYEDLLKKGMK

    >gi|194098368|ref|YP_002001426.1| Methylated-DNA-protein-cysteinemethyltransferase [Neisseria gonorrhoeae NCCP11945]
    MPQPDPQGFRRSLFLYRRAGMAEIGDFAVKFMIGIRSKRMITLPSLNNLPSKWDEIRHCLETRVFECGVMPYPNLTECEA
    GQFERDFWDNIGCAPEEYVRIRRAIRLLELRYPDSLNELVCAAIATPLGEMLAVFGVKGLCLLEFVGQKYLEQEIAAVQK
    ALRGRFVFREDGRMQFLRQELDLYFQCRLKTFATPLEMIGTAFQKQAWDVLLAIPYGETRSYKEQAQRLGNPKAVRAVAA
    ANGQNKVSVMIP
    CHRVIGSDGKLTGYAGGLNRKQFLLALERGEVQTALF

    >gi|194098382|ref|YP_002001440.1| thiol:disulfide interchange protein precursor [Neisseria gonorrhoeae NCCP11945]
    MRTNYLSETDSIMKKLICLFAVFLMLCGRAFALDANDLLPPEKAFVPELTVADDGVNVRFRIADGYYMYQAKIVGKTDPA
    DLLGQPSFSKGEEKEDEFFGRQTVHHHEAQVAFPYAKAVGEPYKLVLTYQGCAEAGVCYPPVDTEFDISGNGTYHPQTDE
    PASAKDRFLQPSSQNGSGALPPPKGDEGGDGRFKLSWDTLNANLLAFFLAGLGLSFTACMYPLLPIVSSIVVGDKKAGKA
    RAFVLSVVYVQGLALTYTLVGIVAGLTGALLTVWLQQAWVVLAASALMVVLALSMFGLFNIQLPNAVQSYFQNQSSRLSG
    GKIVSVFIMGILSALIVGPCVAPPLAFALGYIGQTGDAVLGGLALYTLALGTGVPLIAIGTFGGHILPKAGDWMNAVKYA
    FGFILLAVAVYLATPHLPYYLVVALYTLLMLVPAFMLLVNGRRQKRRPKAVAFALGSILLIGGAWFGWQGANGKTTALHH
    FLTLNPPAEAGKFSEHGKMFADTAALKAAMDTALKEHPDKPVVLDFYADW
    CISCKEMAVYTLNQPEVHQAVDMERFFQID
    VTANTPEHQALLKEYGLFGPPGVFVVRADGSRSEPLLGFVKADKFIEWYEQNR

    >gi|194098439|ref|YP_002001498.1| Peroxiredoxin 2 family protein/glutaredoxin [Neisseria gonorrhoeae NCCP11945]
    MALQDRTGQKVPSVVFRTRVGDTWKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYNELFGAFKENGVDAICCVSVN
    DTFVMNAWAAEEESDNIYMIPDGNGEFTEGMGMLVGKEDLGFGKRSWRYSMLVNDGVVEKMFIEPEEPGDPFKVSDADTM
    LKFVAPDWKAQESVAIFTKPG
    CQFCAKVKQALQDKGLSYEEIVLGKDATVTSVRAITGKMTAPQVFIGGKYIGGSEDLEA
    YLAKN

    >gi|194098440|ref|YP_002001499.1| dihydrolipoamide dehydrogenase [Neisseria gonorrhoeae NCCP11945]
    MLSETDMFCVGNVSDENGRTKIMKKIQADIVVIGGGTAGMGAFRNARLHSDNVYLIENNVFGTTCARVGCMPSKLLIAAA
    EARHHALHTDPFGVHLDKDSIVVNGEEVMRRVKSERDRFVGFVVTDVEEWPADKRIMGSAKFIDEHTVQIDDHIQIAAKS
    FVIATGSRPVILPQWQSLGDRLIINDDVFSWDTLPKRVAVFGPGVIGLELGQALHRLGVKVEIFGLGGIIGGISDPVVSD
    EAKAVFGEELKLHLDAKTEVKLDADGNVEVHWEQDGEKGVFVAEYMLAAVGRRPNVDNIGLENINIDKDARGVPVADPLT
    MQTSIPHIFIAGDASNQLPLLHEAADQGKIAGDNAGRYPNIGSGLRRSTIGVVFTSPQIGFVGLKYAQVAAQYQADEFVI
    GEVSFKNQGRSRVMLVNKGHMRLYAEKATGRFIGAEIVGPAAEHLAHLLAWAHQMKMTVPQMLDMPFYHPVIEEGLRTAL
    RDADAKLKA

    >gi|194098451|ref|YP_002001510.1| dihydrolipoamide dehydrogenase [Neisseria gonorrhoeae NCCP11945]
    MSQYDVVVIGAGPGGYVAAIRAAQLGFKTACVDAGVNKAGNAPALGGTCLNVGCIPSKALLQSSEHFHAAQHDFAEHGIT
    VGDVKFDVAKMIERKDAIVTKLTGGVKFLFQKNKVTSLFGTASFAGKNGDAYQIEVDNKGEKTVIEAKHVIVATGSVPRP
    LPQVAIDNVNVLDNEGALNLTEVPAKLGVIGSGVIGLEMGSVWNRVGAEVTILEAAPTFLAAADQQIAKEAFKYFTKEQG
    LSIELGVKIGDIKSEGKGVSVAYETAAGEAKTEVFDKLIVAIGRIPNTKGLNAEAVGLEKDERGFIKVDGECRTNLPNVW
    AIGDVVRGPMLAHKASDEGVAVAERIAGQKPHIDFNNVPFVIYTDPEIAWVGKTEEQLKAEGVEYKKGTSGFGANGRALA
    MGKAKGTVKVLADAKTDRILGVHMIGPVVSELVTEGVTALEFFASSEDIARIIHAHPTLSEVVHEAALAADKRALHG

    >gi|194098482|ref|YP_002001542.1| Macrophage infectivity potentiator-related protein [Neisseria gonorrhoeae NCCP11945]
    MARLTVHTLETAPEAAKPRVEAVLKNNGFIPNLIGVLANAPEALAFYQEVGKLNAANSLTAGEVEVIRIIAARTNQCGFC
    VAGHTKLATLKKLLSEQSLNAARALAAGEFDDAKLGALAAFTQAVMAKKGAVSDDELKAFFDAGYNRQQAVEVVMGVALA
    TLCNYANNLAQTEINPKLQAYA

    >gi|194098643|ref|YP_002001705.1| DsbC [Neisseria gonorrhoeae NCCP11945]
    MGDNIAYVQENGRYFIFGALYDMQEQKDLTEMARSAVTQKSYSRLPFKNAIKIVKGNGGKGKREFALFSDPDCPFCRRLE
    ETLAGMTDYTAYVFMFPIKSLHPDAISKAEHIWCSKDREKAWNNYMLMDKEPAAGNCKNPVSENIALAEQLKVRGTPSMI
    HKDGRRTSGAMPRAELEKWLNGAGAE

    >gi|194098676|ref|YP_002001738.1| hypothetical protein NGK_1113 [Neisseria gonorrhoeae NCCP11945]
    MIILHGIPNCDTVKKAKNRLAGYGLEFGFRDFKKQMPSEAEICSWLEQVPLATLFNKRGTSWRKLDAETQQKALSSTAEA
    VKLMSEMPSLIKRPVLECGSRVYVGFSEETYDGIFNRQAPCRQG

    >gi|194098784|ref|YP_002001846.1| putative P-type cation-transporting ATPase [Neisseria gonorrhoeae NCCP11945]
    MKKTCFHCGLDVPENLHLTVRYEGEDRETCCVGCQAVAQSIIDSGLGSYYKRRTADAKKTELPPQEILDQIRLYDLPEVQ
    SDFVETHNGTHEAVLMLSGIT
    CAACVWLIEQQLLRTDGIVRIDLNYSTHRCRVVWDDGKIRLSDILLKIRQTGYTAAPYD
    AQKIEAANQKERKQYIVRLAVAGLGMMQTMMFALPTYLYGGDIEPDFLQILHWGGFLMVLPVVFYCAVPFYQGALRDLKN
    RRAGMDTPIAAAIIMTFIAGIYSLATNAGQGMYFESIAMLLFFLLGGRFMEHIARRKAGDAAERLVKLIPAFCHRMPGYP
    AVQDVRESAVVKLQAGDIVMVKPGETIPVDGTVLEGNSAVNESMLTGESLPVAKMPSEKVTAGTLNTQSPLIIRTDRTGG
    GTRLSHIVRLLDRALAQKPRTAELAEQYASSFIFGELLLAVPVFIGWTLYADAHTALWITVALLVITCPCALSLATPTAL
    AASTGTLAREGILIGGKQAIETLSQTTDIIFDKTGTLTQGNPAVRRIELLGSMTEAQVLAVAQSLEQQSEHPLARAILNC
    RISGGSVPEIQVGQRLNRIGEGVGAQLTVNGETQVWALGRASYVAEISGKEPQTEGGGSAVYLGSQSGFQAVFYLQDPLK
    DSAAEAVRQLAGKNLTLHILSGDREEAVAETARALGIAHYRAQAMPEDKLEYVEALQKEGKKVLMIGDGINDAPVLAQAD
    VSAAAAGGTDIARDGADIVLLNEDLRTVAHLLDQARRTRHIIRQNLIWAGAYNIIAVPLAVLGYVQPWIAALGMSFSSLA
    VLGNALRLHKRGKMPSEKILSEQ

    >gi|194098820|ref|YP_002001883.1| putative thioredoxin I [Neisseria gonorrhoeae NCCP11945]
    MPKPYPARYRANPNRKGKIMSSELIVHTGDAAFEQDVLKSDLPVLLDFWAPWCGPCKMIAPILDDIAAEFEGRLKVVKIN
    IDDNEATPSRFGVRGIPTLMVFKNGEVVATKVGALAKGQLTAFVEASIA

    >gi|194098844|ref|YP_002001907.1| HesB/YadR/YfhF family protein [Neisseria gonorrhoeae NCCP11945]
    MPSEPPAASDPSGAVQQGRNMITLTENAAKHINDYLAKRGKGLGVRLGVKTSGCSGMAYNLEFVDEANGDDLIFEGHGAR
    IYIDPKSLVYLDGTQVDYTKEDLQEGFKFENPNVKDSCGCGESFHV

    >gi|194098901|ref|YP_002001966.1| putative thioredoxin reductase [Neisseria gonorrhoeae NCCP11945]
    MSQHRKLIILGSGPAGYTAAVYAARANLNPVIITGIAQGGQLMTTTEVDNWPADADGVQGPELMARFLAHAERFGTEIIF
    DQINAVDLQKRPFALKGDMGEYTCDALIVATGASAKYLGLPSEEAFAGKGVSA
    CATCDGFFYKNQDVAVVGGGNTAVEEA
    LYLANIAKTVTLIHRRSEFRAEKIMIDKLMKRVEEGKIILKLESNLQEVLGDDRGVNGALLKNNDGSDQQIAVSGIFIAI
    GHKPNTDIFKGQLEMDEAGYLKTKGGTADNVGATNIEGVWAAGDVKDHTYRQAITSAASGCQAALDAERWLGSQNI

    >gi|194098902|ref|YP_002001967.1| putative transport ATPase [Neisseria gonorrhoeae NCCP11945]
    MSSFRILPELSARLRNFDHTGVQTASRSLDCRLNIKTGIKLMQQKIRFQIEGMTCQACASRIEKVLNKKDFVESAGVNFA
    SEEAQVTFDGSKTSVADIAKIIEKTGYGAKEKTEDTLPQPEAEHHIGWRLWLLLTINIPFLIGMVGMMLKGLNWTRHDWM
    IPPVWQFVLASIVQLWLAIPFYKSAWASIKGGLANMDVLVTIGTVSIYLYSVYMLFFSSHAAHGMAHVYFEAGVMVIGFV
    SLGKFLEHRTKKSSLNSLGLLLKLTPTQVNVQRNGEWKQLPIDQVQIGDLIRTNHGERIAADGIIESGSGWADESHLTGE
    SNPEEKKAGGKVLAGALMTEGSVVYRAAQLGSQTLLGDMMNALSEAQGSKAPIARVADKAAAVFVPTVVGIALLTFIVTW
    LIKGDWTVALMHAVAVLVIACPCALGLATPAAIMVGMGKAVKHGIWFKDAAAMEEAAHVDAVVLDKTGTLTEGRPQVAAV
    YYVPDSGFDEDALYRIAAAVEQNAAHPLARAIVSAAQARGLEIPAAQNAQTVVGAGITAEVEGVGLVKSGKAEFAELTLP
    KFSDGVWEIASAVTVSVNGKPIGAFALSDALKADTAEAIGRLKKHNIDVYIMSGDNQSTVEYVAKQLGIAHAFGNMSPCD
    KAAEVQKLKAAGKTVAMVGDGINDAPALAAANVSFAMKGGADVAEHTASATLMQHSVNQLADALLISQATLENIKQNLFF
    AFFYNILGIPLAALGFLNPVIAGAAMAASSVSVLGNALRLKWVKID

    >gi|194098922|ref|YP_002001987.1| putative dihydrolipoamide dehydrogenase [Neisseria gonorrhoeae NCCP11945]
    MALVELKVPDIGGHENVDIIAVEVNVGDTIAVDDTLITLETDKATMDVPAEVAGVIKEVKVKVGDKISEGGLIVVVEAEG
    AAAAPKAEAAAAPAQEAPKAAAPAPQAAQFGSAADAEYDVVVLGGGPGGYSAAFAAADEGLKVAIVERYKTLGGV
    CLNVG
    CIPSKALLHNAAVIDEVRHLAANGIKYPEPELDIDMLRAYKDGVVSRLTGGLAGMAKSRKVDVIQGDGQFLDPHHLEVSL
    TAGDAYEQAAPTGEKKIVAFKNCIIAAGSRVTKLPFIPEDPRIIDSSGALALKEVPGKLLIIGGGIIGLEMGTVYSTLGS
    RLDVVEMMDGLMQGADRDLVKVWQKQNEYRFDNIMVNTKTVAVEPKEDGVYVTFEGANAPKEPQRYDAVLVAAGRAPNGK
    LISAEKAGVAVTDRGFIEVDKQMRTNVPHIYAIGDIVGQPMLAHKAVHEGHVAAENCAGHKAYFDARVIPGVAYTSPEVA
    WVGETELSAKASGRKITKANFPWAASGRAIANGCDNGFTKLIFDAETGRIIGGGIVGPNGGDMIGEVCLAIEMGCDAADI
    GKTIHPHPTLGESIGMAAEVALGVCTDLPPQKKK

    >gi|194099053|ref|YP_002002134.1| Dsb [Neisseria gonorrhoeae NCCP11945]
    MTPLFRKAVWLLFAVSVCAFAGSLAAQYVLGMEPCVLCISQRLCVLATALCAAVVLACKPKGRVGGLSGAVFISIPAVTG
    ISVAAYQLWLQSLPPGTAPS
    CGAPWTFRLKGWPLFDWFEPVVRGFGNCAEPDYLLGVALPVWSAAYFLAVVLTVWWAWAR
    AK

    >gi|194099158|ref|YP_002002243.1| glutaredoxin 2 [Neisseria gonorrhoeae NCCP11945]
    MKLYIYDHCPFCVRARMAAGLFGADVEEVVLANDDEATPIGMIGAKQVPVLQKEDGSFMGESLDIVCHFDREGRLKDEVR
    PEIQAWLDKVGGYNNKLVQPRLIKIGLPEFVTPEAVKYFTDKKEKSIGSFSANLNKTAQYLERINADLQELENLMDGTSD
    GINGGIGMEDILVFPVLRNLTVVRGIAFPRKTMDYLIGMSEKSGVPLYFDRAL

    >gi|194099205|ref|YP_002002296.1| Na(+)-translocating NADH-quinone reductase subunit D [Neisseria gonorrhoeae NCCP11945]
    MKRLKHLMFSPFIDNNPIALQVLGICSALAVTTKLQTAIVMGISVALVTGFSSFFISLVRNYIPNSIRIIVQMAIIASLV
    TLVDQLLQAFAYELSKQLSVFVGLIITN
    CIVMGRAEAFAMKEPPLESLIDGIGNGAGYGMMLLVVATVRELIGSGKLLGY
    TVFQTVQDGGWYQTNGLFLLAPSAFFIIGFLIWGLRTWKPEQAEE

    >gi|194099206|ref|YP_002002297.1| Na(+)-translocating NADH-quinone reductase subunit E [Neisseria gonorrhoeae NCCP11945]
    MEHYLSLFIKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVIFVLGLSVPANQLVYSLLKDGAIVEGVDLTFLKFI
    TFIGVIAALVQILEMFLDKFVPALYNALGIYLPLITVN
    CAIFGAVSFMAQREYDFGESVVYGFGAGLGWMLAIVALAGIT
    EKMKYSDAPKGLKGLGITFIAAGLMAMAFMSFSGIQL

    >gi|194099218|ref|YP_002002309.1| Putative iron-sulfur cluster insertion protein erpA [Neisseria gonorrhoeae NCCP11945]
    MKLQAVKLIYWDNSFFKGEALLAFEGGLRENAENIILRNNTMSDESPIIFTDSCCAKVADLIAEENNPDLKLRVFVNGGG
    CSGFQYGFTFDEIKNDDDFEIEKNGLVFLVDPMSYQYLVGAEIDYTESLQGSQFVIRNPNAETTCGCGSSFSV

    >gi|194099233|ref|YP_002002324.1| Thiol:disulphide interchange protein [Neisseria gonorrhoeae NCCP11945]
    MKTKLIKILTPFTVLPLLACGQTPVSNANAESAVKAESAGKSVAASLKARLEKTYSAQDLKVLSVSETPVKGIYEVVVSG
    RQIIYTDAEGGYMFVGELINIDTRKNLTEERAADLNKIDFASLPLDKAIKEVRGNGKLKVAVFSDPD
    CPFCKRLEHEFEK
    MTDVTVYSFMMPIAGLHPDAARKAQILWCQPDRAKAWTDWMRKGKFPVGGSICDNPVAETTSLGEQFGFNGTPTLVFPNG
    RTQSGYSPMPQLEEIIRKNQQ

    >gi|194099363|ref|YP_002002463.1| DsbA [Neisseria gonorrhoeae NCCP11945]
    MKFKHLLPLLLSAVLSAQAYALTEGEDYLVLDKPIPQEQPGKIEVLEFFGYFCVHCHHFDPLLLKLGKALPSDTYLRTEH
    VVWRPEMLGLARMAAAVKLSGLKYQANSAVFKAVYEQKIRLENRAVAGKWALSQKGFDGKKLMRAYDSPEAAAVALKMQK
    LTEQYGIDGTPTVIVGGKYRVIFNNGFDGGVHTIKELVAKVREERKRQTPAVQK

    >gi|194099610|ref|YP_002002741.1| putative thiol:disulphide interchange protein [Neisseria gonorrhoeae NCCP11945]
    MKSRHLALGVAALFALAACDSKVQTSVPADSAPAASAAAAPAGLVEGQNYTVLANPIPQQQAGKVEVLEFFGYFCPHCAR
    LEPVLSKHAKSFKDDMYLRTEHVVWQKEMLPLARLAAAVDMAAAESKDVANSHIFDAMVNQKIKLQEPEVLKKWLGEQTA
    FDGKKVLAAYESPESQARAGKMQELTETFQIDGTPTVIVGGKYKVEFADWESGMNTIDLLADKVREEQKAAQ

    >gi|194099662|ref|YP_002002797.1| trifunctional thioredoxin/methionine sulfoxide reductase A/B protein [Neisseria gonorrhoeae NCCP11945]
    MQTVHTGNIKMKHRTFFSLCAKFGCLLALGACSPKIVDAGTATVPHTLSTLKTADNRPASVYLKKDKPTLIKFWASWCPL
    CLSELGQAEKWAQDAKFSSANLITVASPGFLHEKKDGEFQKWYAGLNYPKLPVVTDNGGTIAQNLNISVYPSWALIGKDG
    DVQRIVKGSINEAQALALIRNPNADLGSLKHSFYKPDTQKKDSAIMNTRTIYLAGG
    CFWGLEAYFQRIDGVVDAVSGYAN
    GNTENPSYEDVSYRHTGHAETVKVTYDADKLSLDDILQYYFRVVDPTSLNKQGNDTGTQYRSGVYYTDPAEKAVIAAALK
    REQQKYQLPLVVENEPLKNFYDAEEYHQDYLIKNPNGYCHIDIRKADEPLPGKTKAAPQGKGFDAATYKKPSDAELKRTL
    TEEQYQVTQNSATEYAFSHEYDHLFKPGIYVDVVSGEPLFSSADKYDSGCGWPSFTRPIDAKSVTEHDDFSFNMRRTEVR
    SRAADSHLGHVFPDGPRDKGGLRY
    CINGASLKFIPLEQMDAAGYGALKGKVK

    >gi|194099707|ref|YP_002002842.1| ThiF [Neisseria gonorrhoeae NCCP11945]
    MNAARRRRYNRPQLFFPNIIMTATEHDNDDALLLRYSRHILLDEIGIEGQQKLSAAHILVVGCGGLGAAALPYLAASGVG
    TLTIADSDTVELHNLQRQVAFDEGDVGKPKAETLAGRLKRINHTVDVRAVNEKLDGCRLTGLVQTADIVLDCCDNYATRQ
    AVNRACVQTKTPLVSGAAVRFEGQLAAYRPDLPDSPCYACLFDGGSASDGI
    CSLFGVLSPLVGIVGCTQAAEALKILLEA
    GEPSHGRLAVYRALEGGWQYFDLPRNPECPVCGAAR

    >gi|194099818|ref|YP_002002953.1| ArsC [Neisseria gonorrhoeae NCCP11945]
    MSEIKIFHNPRCSKSRAAVSLLEERGIAAEAVKYLDTPPDLSELKDIFNKLGLESARGMMRVKDDLYKELGLDNPDLDND
    ALLRAIADHPALLERPIVLANGKAAVGRPLENIEAVL

    >gi|194099819|ref|YP_002002954.1| putative thioredoxin [Neisseria gonorrhoeae NCCP11945]
    MKRLNLAAIALAATFAAHTASADELAGWKDNTPQNLQSLKAPVRIANLWATWCGPCRKEMPAMSKWYKAQKKGSVDMVGI
    ALDTSDNIGNFLKQTPVSYPIWRYTGANSRNFMKSYGNNVGVLPFTVVEAPKCGYRQTITGEVNEKSLTEAVKLAHSKCR


    >gi|194100082|ref|YP_002003222.1| putative thioredoxin [Neisseria gonorrhoeae NCCP11945]
    MKKILTAAAVALIGILLATVLIPDSKTAPAFSLPDLHGKTVSNADLQGKVTLINFWFPSCPGCVSEMPKVIKTANDYKNK
    DFQVLAVAQPIDPIESVRQYVKDYGLPFTVIYDADKAVGQAFGTQVYPTSVLIGKKGEILKTYVGEPDFGKLYQEIDTAL
    AQ

    >gi|194100089|ref|YP_002003229.1| regF [Neisseria gonorrhoeae NCCP11945]
    MMTLYSGITCPFSHRCRFVLYEKGMDFEIKDIDIYNKPEDLAVMNPYNQVPVLVERDLVLHESNIINEYIDERFPHPQLM
    PGDPVMRGRGRLVLYRMEKELFNHVQVLENPAAANKEQAKAREAIGNGLTMLSPSFSKSKYILGEDFSMIDVALAPLLWR
    LDHYDVKLGKSAAPLLKYAERIFQREAFIEALTPAEKAMRK