Neisseria gonorrhoeae FA 1090 uid57611

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|59800489|ref|YP_207201.1| hypothetical protein NGO0020 [Neisseria gonorrhoeae FA 1090]
    MDIVQLPSAALKAWMDEGRMFCLLDVRTDEEAAVCSLPNALHIPMNLIPLRQNELPDDVPLVVYCHHGIRSLHTAMYLAE
    AGFENLYNLQGGIDAWAVEVDAEMARY

    >gi|59800522|ref|YP_207234.1| putative thioredoxin [Neisseria gonorrhoeae FA 1090]
    MKKKLLSGIKFAVRTALVFLLVSLFLDWVRKPDEPAGAAGRPLTLLSGQRLTLGQFSRDRTVLVYFWGSWCGVCRYQSPI
    IDDLAADGVPVVGVAVRSGSASEVAAYMAKRGLGFPTVSDEDGGLARSWRIAATPAVVLVKNGKMVRYTTGISSYWGLRA
    RIFQADFFG

    >gi|59800574|ref|YP_207286.1| putative glutaredoxin [Neisseria gonorrhoeae FA 1090]
    MQTVTMYTGPFCPYCAMAKRLLHAAGVGHIDEIRVDASPEAFAEMQRLSGQRSVPQIFIGETHVGGFTDLYRLQQEGGLD
    GLLNP

    >gi|59800774|ref|YP_207486.1| hypothetical protein NGO0328 [Neisseria gonorrhoeae FA 1090]
    MAIAAVRLRAVLNNGNIGSRTMDMKYEFTLPSSSGADFHSAEHLPLVVYFYPKDSTPGCTTEGLDFNARLEQFEALGYTV
    VGISRDGVKAHQNFCAKQGFRFELLSDKDETVCRLFDVIKLKKLYGKESLGIERSTFVLNKDGEIVREWRKVKVAGHAQE
    VLETLSR

    >gi|59800777|ref|YP_207489.1| hypothetical protein NGO0331 [Neisseria gonorrhoeae FA 1090]
    MKLTLMFREYCSLCHKMRDALKPFQDEYGFGLEVVDVDENPVLEEKYNELIPVLLAGDEEICHWFLDEDRLKQFLER

    >gi|59800795|ref|YP_207507.1| glutaredoxin-like protein GrlA [Neisseria gonorrhoeae FA 1090]
    MASIHDQIKEVVTTHRVVLFMKGTKQFPQCGFSSRAVQILNAAGCTDYVAVNVLENPEVRQGIKEYSDWPTIPQLYVNGE
    FVGGSDILMEMYEAGELQELLKA

    >gi|59800813|ref|YP_207525.1| hypothetical protein NGO0369 [Neisseria gonorrhoeae FA 1090]
    MALGHRCRRFGTDKITSRPLRRQPQENPMNIKQLITAALIASAAFATQAAPQKPVSAAQTAQHSAVWIDVRSEQEFSEGH
    LHNAVNIPVDQIVRRIYEAAPDKDTPVNLY
    CRSGRRAEAALQELKKAGYTNVANHGGYEDLLKKGMK

    >gi|59800995|ref|YP_207707.1| putative dihydrolipoamide dehydrogenase [Neisseria gonorrhoeae FA 1090]
    MALVELKVPDIGGHENVDIIAVEVNVGDTIAVDDTLITLETDKATMDVPAEVAGVIKEVKVKVGDKISEGGLIVVVEAEG
    AAAAPKAEAAAAPAQEAPKAAAPAPQAAQFGGAADAEYDVVVLGGGPGGYSAAFAAADEGLKVAIVERYKTLGGV
    CLNVG
    CIPSKALLHNAAVIDEVRHLAANGIKYPKPELDIDMLRAYKDGVVSRLTGGLAGMAKSRKVDVIQGDGQFLDPHHLEVSL
    TAGDAYEQAAPTGEKKIVAFKNCIIAAGSRVTKLPFIPEDPRIIDSSGALALKEVPGKLLIIGGGIIGLEMGTVYSTLGS
    RLDVVEMMDGLMQGADRDLVKVWQKQNEYRFDNIMVNTKTVAVEPKEDGVYVTFEGANAPKEPQRYDAVLVAAGRAPNGK
    LISAEKAGVAVTDRGFIEVDKQMRTNVPHIYAIGDIVGQPMLAHKAVHEGHVAAENCAGHKAYFDARVIPGVAYTSPEVA
    WVGETELSAKASGRKITKANFPWAASGRAIANGCDNGFTKLIFDAETGRIIGGGIVGPNGGDMIGEVCLAIEMGCDAADI
    GKTIHPHPTLGESIGMAAEVALGVCTDLPPQKKK

    >gi|59801010|ref|YP_207722.1| putative transport ATPase [Neisseria gonorrhoeae FA 1090]
    MQQKIRFQIEGMTCQACASRIEKVLNKKDFVESAGVNFASEEAQVTFDGSKTSVADIAKIIEKTGYGAKEKTEDTLPQPE
    AEHHIGWRLWLLLTINIPFLIGMVGMMLKGLNWTRHDWMIPPVWQFVLASIVQLWLAIPFYKSAWASIKGGLANMDVLVT
    IGTVSIYLYSVYMLFFSSHAAHGMAHVYFEAGVMVIGFVSLGKFLEHRTKKSSLNSLGLLLKLTPTQVNVQRNGEWKQLP
    IDQVQIGDLIRTNHGERIAADGIIESGSGWADESHLTGESNPEEKKAGGKVLAGALMTEGSVVYRAAQLGSQTLLGDMMN
    ALSEAQGSKAPIARVADKAAAVFVPTVVGIALLTFIVAWLIKGDWTVALMHAVAVLVIACPCALGLATPAAIMVGMGKAV
    KHGIWFKDAAAMEEAAHVDAVVLDKTGTLTEGRPQVAAVYYVPDSGFDEDALYRIAAAVEQNAAHPLARAIVSAAQARGL
    EIPAAQNAQTVVGAGITAEVEGVGLVKSGKAEFAELTLPKFSDGVWEIASAVTVSVNGKPIGAFALSDALKADTAEAIGR
    LKKHNIDVYIMSGDNQSTVEYVAKQLGIAHAFGNMSPCDKAAEVQKLKAAGKTVAMVGDGINDAPALAAANVSFAMKGGA
    DVAEHTASATLMQHSVNQLADALLISQATLENIKQNLFFAFFYNILGIPLAALGFLNPVIAGAAMAASSVSVLGNALRLK
    WVKID

    >gi|59801011|ref|YP_207723.1| putative thioredoxin reductase [Neisseria gonorrhoeae FA 1090]
    MSQHRKLIILGSGPAGYTAAVYAARANLNPVIITGIAQGGQLMTTTEVDNWPADADGVQGPELMARFLAHAERFGTEIIF
    DQINAVDLQKRPFALKGDMGEYTCDALIVATGASAKYLGLPSEEAFAGKGVSA
    CATCDGFFYKNQDVAVVGGGNTAVEEA
    LYLANIAKTVTLIHRRSEFRAEKIMIDKLMKRVEEGKIILKLESNLQEVLGDDRGVNGALLKNNDGSDQQIAVSGIFIAI
    GHKPNTDIFKGQLEMDEAGYLKTKGGTADNVGATNIEGVWAAGDVKDHTYRQAITSAASGCQAALDAERWLGSQNI

    >gi|59801060|ref|YP_207772.1| hypothetical protein NGO0632 [Neisseria gonorrhoeae FA 1090]
    MITLTENAAKHINDYLAKRGKGLGVRLGVKTSGCSGMAYNLEFVDEANGDDLIFEGHGARIYIDPKSLVYLDGTQVDYTK
    EDLQEGFKFENPNVKDSCGCGESFHV

    >gi|59801079|ref|YP_207791.1| putative thioredoxin I [Neisseria gonorrhoeae FA 1090]
    MSSELIVHTGDAAFEQDVLKSDLPVLLDFWAPWCGPCKMIAPILDDIAAEFEGRLKVVKINIDDNEATPSRFGVRGIPTL
    MVFKNGEVVATKVGALAKGQLTAFVEASIA

    >gi|59801112|ref|YP_207824.1| putative P-type cation-transporting ATPase [Neisseria gonorrhoeae FA 1090]
    MKKTCFHCGLDVPENLHLTVRYEGEDRETCCVGCQAVAQSIIDSGLGSYYKRRTADAKKTELPPQEILDQIRLYDLPEVQ
    SDFVETHNGTHEAVLMLSGIT
    CAACVWLIEQQLLRTDGIVRIDLNYSTHRCRVVWDDGKIRLSDILLKIRQTGYTAAPYD
    AQKIEAANQKERKQYIVRLAVAGLGMMQTMMFALPTYLYGGDIEPDFLQILHWGGFLMVLPVVFYCAVPFYQGALRDLKN
    RRAGMDTPIAAAIIMTFIAGIYSLATNAGQGMYFESIAMLLFFLLGGRFMEHIARRKAGDAAERLVKLIPAFCHRMPGYP
    AVQDVRESAVVKLQAGDIVMVKPGETIPVDGTVLEGNSAVNESMLTGESLPVAKMPSEKVTAGTLNTQSPLIIRTDRTGG
    GTRLSHIVRLLDRALAQKPRTAELAEQYASSFIFGELLLAVPVFIGWTLYADAHTALWITVALLVITCPCALSLATPTAL
    AASTGTLAREGILIGGKQAIETLSQTTDIIFDKTGTLTQGNPAVRRIELLGSMTEAQVLAVAQSLEQQSEHPLARAILNC
    RISGGSVPEIQVGQRLNRIGEGVGAQLTVNGETQVWALGRASYVAEISGKEPQTEGGGSAVYLGSQSGFQAVFYLQDPLK
    DSAAEAVRQLAGKNLTLHILSGDREEAVAETARALGIAHYRAQAMPEDKLEYVEALQKEGKKVLMIGDGINDAPVLAQAD
    VSAAAVGGTDIARDGADIVLLNEDLRTVAHLLDQARRTRHIIRQNLIWAGAYNIIAVPLAVLGYVQPWIAALGMSFSSLA
    VLGNALRLHKRGEMPSEQ

    >gi|59801180|ref|YP_207892.1| hypothetical protein NGO0765 [Neisseria gonorrhoeae FA 1090]
    MIILHGIPNCDTVKKAKNRLAGYGLEFGFRDFKKQMPSEAEICSWLEQVPLATLFNKRGTSWRKLDAETQQKALSSTAEA
    VKLMSEMPSLIKRPVLECGSRVYVGFSEETYDGIFNRQAPCRQG

    >gi|59801286|ref|YP_207998.1| hypothetical protein NGO0887 [Neisseria gonorrhoeae FA 1090]
    MARLTVHTLETAPEAAKPRVEAVPKNNGFIPNLIGVLANAPEALAFYQEVGKLNAANSLTAGEVEVIRIIAVRTNQCSFC
    VAGHTKLATLKKLLSEQSLNAARALAAGKSDDAKLGALAAFTQAVMAKKGAVSDDELNAFLEAGYNRQQAVEVVMGVALA
    TLCNYANNLAQTEINPKLQAYA

    >gi|59801311|ref|YP_208023.1| dihydrolipoamide dehydrogenase [Neisseria gonorrhoeae FA 1090]
    MSQYDVVVIGAGPGGYVAAIRAAQLGFKTACVDAGVNKAGNAPALGGTCLNVGCIPSKALLQSSEHFHAAQHDFAEHGIT
    VGDVKFDAAKMIERKDAIVTKLTGGVKFLFQKNKVTSLFGTASFAGKNGDAYQIEVDNKGEKTVIEAKHVIVATGSVPRP
    LPQVAIDNVNVLDNEGALNLTEVPAKLGVIGSGVIGLEMGSVWNRVGAEVTILEAAPTFLAAADQQIAKEAFKYFTKEQG
    LSIELGVKIGDIKSEGKGVSVAYETAAGEAKTEVFDKLIVAIGRIPNTKGLNAEAVGLEKDERGFIKVDGECRTNLPNVW
    AIGDVVRGPMLAHKASDEGVAVAERIAGQKPHIDFNNVPFVIYTDPEIAWVGKTEEQLKAEGVEYKKGTSGFGANGRALA
    MGKAKGTVKVLADAKTDRILGVHMIGPVVSELVTEGVTALEFFASSEDIARIIHAHPTLSEVVHEAALAADKRALHG

    >gi|59801321|ref|YP_208033.1| dihydrolipoamide dehydrogenase [Neisseria gonorrhoeae FA 1090]
    MKKIQADIVVIGGGTAGMGAFRNARLHSDNVYLIENNVFGTTCARVGCMPSKLLIAAAEARHHALHTDPFGVHLDKDSIV
    VNGEEVMRRVKSERDRFVGFVVTDVEEWPADKRIMGSAKFIDEHTVQIDDHIQIAAKSFVIATGSRPVILPQWQSLGDRL
    IINDDVFSWDTLPKRVAVFGPGVIGLELGQALHRLGVKVEIFGLGGIIGGISDPVVSDEAKAVFGEELKLHLDAKTEVKL
    DADGNVEVHWEQDGEKGVFVAEYMLAAVGRRPNVDNIGLENINIDKDARGVPVADPLTMQTSIPHIFIAGDASNQLPLLH
    EAADQGKIAGDNAGRYPNIGSGLRRSTIGVVFTSPQIGFVGLKYAQVAAQYQADEFVIGEVSFKNQGRSRVMLVNKGHMR
    LYAEKATGRFIGAEIVGPAAEHLAHLLAWAHQMKMTVPQMLDMPFYHPVIEEGLRTALRDADAKLKA

    >gi|59801322|ref|YP_208034.1| putative peroxiredoxin family protein/glutaredoxin [Neisseria gonorrhoeae FA 1090]
    MALQDRTGQKVPSVVFRTRVGDTWKDVSTDDLFKGKKVVVFSLPGAFTPTCSSSHLPRYNELFGAFKENGVDAICCVSVN
    DTFVMNAWAAEEESDNIYMIPDGNGEFTEGMGMLVGKEDLGFGKRSWRYSMLVNDGVVEKMFIEPEEPGDPFKVSDADTM
    LKFVAPDWKAQESVAIFTKPG
    CQFCAKVKQALQDKGLSYEEIVLGKDATVTSVRAITGKMTAPQVFIGGKYIGGSEDLEA
    YLAKN

    >gi|59801364|ref|YP_208076.1| thiol:disulfide interchange protein precursor [Neisseria gonorrhoeae FA 1090]
    MRTNYLSETDSIMKKLICLFAVFLMLCGRAFALDANDLLPPEKAFVPELTVADDGVNVRFRIADGYYMYQAKIVGKTDPA
    DLLGQPSFSKGEEKEDEFFGRQTVHHHEAQVAFPYAKAVGEPYKLVLTYQGCAEAGVCYPPVDTEFDISGNGTYHPQTDE
    PASAKDRFLQPSSQNGSGALPPPKGDEGGDGRFKLSWDTLNANLLAFFLAGLGLSFTACMYPLLPIVSSIVVGDKKAGKA
    RAFVLSVVYVQGLALTYTLVGIVAGLTGALLTVWLQQAWVVLAASALMVVLALSMFGLFNIQLPNAVQSYFQNQSSRLSG
    GKIVSVFIMGILSALIVGPCVAPPLAFALGYIGQTGDAVLGGLALYTLALGTGVPLIAIGTFGGHILPKAGDWMNAVKYA
    FGFILLAVAVYLATPHLPYYLVVALYTLLMLVPAFMLLVNGRRQKRRPKAVAFALGSILLIGGAWFGWQGANGKTTALHH
    FLTLNPPAEAGKFSEHGKMFADTAALKAAMDTALKEHPDKPVVLDFYADW
    CISCKEMAVYTLNQPEVHQAVDMERFFQID
    VTANTPEHQALLKEYGLFGPPGVFVVRADGSRSEPLLGFVKADKFIEWYEQNR

    >gi|59801373|ref|YP_208085.1| putative methylated-DNA-protein-cysteine methyltransferase [Neisseria gonorrhoeae FA 1090]
    MPQPDPQGFRRSLFLYRRAGMAEIGDFAVKFMIGIRSKRMITLPSLNNLPSKWDEIRHCLETRVFECGVMPYPNLTECEA
    GQFERDFWDNIGCAPEEYVRIRRAIRLLELRYPDSLNELVCAAIATPLGEMLAVFGVKGLCLLEFVGQKYLEQEIAAVQK
    ALRGRFVFREDGRMQFLRQELDLYFKGHLKTFATPLEQIGTEFQKQAWDALLAIPYGETRSYKEQAQRLGNPKAVRAVAA
    ANGQNKVSVMIP
    CHRVIGSDGKLTGYAGGLNRKQFLLALERGEVQTALF

    >gi|59801596|ref|YP_208308.1| hypothetical protein NGO1237 [Neisseria gonorrhoeae FA 1090]
    MFSVPRSFLPGVFVLAALAACKPQDNSAAQAASSSASAPAAENAAKPQTRGTDMRKEDIGGDFTLTDGEGKPFSLSDLKG
    KVVILSFGFTH
    CPDVCPTGLLTYSDTLKQLGGQAKDVKVVFVSIDPERDTPEIIGKYAKQFNPDFIGLTATGGQNLPVIK
    QQYRVVSAKINQKDDSENYLVDHSSGAYLIDKNGEVAIFSPYGSEPETIAADVRTLL

    >gi|59801608|ref|YP_208320.1| hypothetical protein NGO1249 [Neisseria gonorrhoeae FA 1090]
    MFKDWKEHTALVKKSFGELGKAHPKILQAYGALEQAAAAEALDAKTRELIAIAVAITTRCESCISVHAAAAAKAGATDSE
    IAGALATAIALNAGAAYTYALRALEAVETQK

    >gi|59801646|ref|YP_208358.1| Dsb [Neisseria gonorrhoeae FA 1090]
    MTPLFRKAVWLLFAVSVCAFAGSLAAQYVLGMEPCVLCISQRLCVLATALCAAVVLACKPKGRVGGLSGAVFISIPAVTG
    ISVAAYQLWLQSLPPGAAPS
    CGAPWTFRLKGWPLFDWFEPVVRGFGNCAEPDYLLGVALPVWSAAYFLAVVLTVWWAWAR
    AK

    >gi|59801729|ref|YP_208441.1| glutaredoxin 2 [Neisseria gonorrhoeae FA 1090]
    MKLYIYDHCPFCVRARMAAGLFGADVEEVVLANDDEATPIGMIGAKQVPVLQKEDGSFMGESLDIVCHFDREGRLKDEVR
    PEIQAWLDKVGGYNNKLVQPRLIKIGLPEFVTPEAVKYFTDKKEKSIGSFSANLNKTAQYLERINADLQELENLMDGTSD
    GINGGIGMEDILVFPVLRNLTVVRGIAFPRKTMDYLIGMSEKSGVPLYFDRAL

    >gi|59801760|ref|YP_208472.1| Na(+)-translocating NADH-quinone reductase subunit D [Neisseria gonorrhoeae FA 1090]
    MADMKRLKHLMFSPFIDNNPIALQVLGICSALAVTTKLQTAIVMGISVALVTGFSSFFISLVRNYIPNSIRIIVQMAIIA
    SLVTLVDQLLQAFAYELSKQLSVFVGLIITN
    CIVMGRAEAFAMKEPPLESLIDGIGNGAGYGMMLLVVATVRELIGSGKL
    LGYTVFQTVQDGGWYQTNGLFLLAPSAFFIIGFLIWGLRTWKPEQAEE

    >gi|59801761|ref|YP_208473.1| Na(+)-translocating NADH-quinone reductase subunit E [Neisseria gonorrhoeae FA 1090]
    MEHYLSLFIKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGVAVIFVLGLSVPANQLVYSLLKDGAIVEGVDLTFLKFI
    TFIGVIAALVQILEMFLDKFVPALYNALGIYLPLITVN
    CAIFGAVSFMAQREYDFGESVVYGFGAGLGWMLAIVALAGIT
    EKMKYSDAPKGLKGLGITFIAAGLMAMAFMSFSGIQL

    >gi|59801769|ref|YP_208481.1| iron-sulfur cluster insertion protein ErpA [Neisseria gonorrhoeae FA 1090]
    MSDESPIIFTDSCCAKVADLIAEENNPDLKLRVFVNGGGCSGFQYGFTFDEIKNDDDFEIEKNGLVFLVDPMSYQYLVGA
    EIDYTESLQGSQFVIRNPNAETTCGCGSSFSV

    >gi|59801780|ref|YP_208492.1| hypothetical protein NGO1438 [Neisseria gonorrhoeae FA 1090]
    MKTKLIKILTPFTVLPLLACGQTPVSNANAESAVKAESAGKSVAASLKARLEKTYSAQDLKVLSVSETPVKGIYEVVVSG
    RQIIYTDAEGGYMFVGELINIDTRKNLTEERAADLNKIDFASLPLDKAIKEVRGNGKLKVAVFSDPD
    CPFCKRLEHEFEK
    MTDVTVYSFMMPIAGLHPDAARKAQILWCQPDRAKAWTDWMRKGKFPVGGSICDNPVAETTSLGEQFGFNGTPTLVFPNG
    RTQSGYSPMPQLEEIIRKNQQ

    >gi|59801884|ref|YP_208596.1| DsbA [Neisseria gonorrhoeae FA 1090]
    MKFKHLLPLLLSAVLSAQAYALTEGEDYLVLDKPIPQEQPGKIEVLEFFGYFCVHCHHFDPLLLKLGKALPSDTYLRTEH
    VVWRPEMLGLARMAAAVKLSGLKYQANSAVFKAVYEQKIRLENRAVAGKWALSQKGFDGKKLMRAYDSPEAAAVALKMQK
    LTEQYGIDSTPTVIVGGKYRVIFNNGFDGGVHTIKELVAKVREERKRQTPAVQK

    >gi|59802038|ref|YP_208750.1| putative thiol:disulphide interchange protein [Neisseria gonorrhoeae FA 1090]
    MKSRHLALALGVAALFALAACDSKVQTSVPADSAPAASAAAAPAGLVEGQNYTVLANPIPQQQAGKVEVLEFFGYFCPHC
    ARLEPVLSKHAKSFKDDMYLRTEHVVWQKEMLPLARLAAAVDMAAAESKDVANSHIFDAMVNQKIKLQEPEVLKKWLGEQ
    TAFDGKKVLAAYESPESQARAGKMQELTETFQIDGTPTVIVGGKYKVEFADWESGMNTIDLLADKVREEQKAAQ

    >gi|59802236|ref|YP_208948.1| putative thioredoxin [Neisseria gonorrhoeae FA 1090]
    MKRLNLAAIALAATFAAHTASADELAGWKDNTPQNLQSLKAPVRIANLWATWCGPCRKEMPAMSKWYKAQKKGSVDMVGI
    ALDTSDNIGNFLKQTPVSYPIWRYTGANSRNFMKSYGNNVGVLPFTVVEAPKCGYRQTITGEVNEKSLTEAVKLAHSKCR


    >gi|59802237|ref|YP_208949.1| ArsC [Neisseria gonorrhoeae FA 1090]
    MSEIKIFHNPRCSKSRAAVSLLEERGIAAEAVKYLDTPPDLSELKDIFNKLGLESARGMMRVKDDLYKELGLDNPDLDND
    ALLRAIADHPALLERPIVLANGKAAVGRPLENIEAVL

    >gi|59802327|ref|YP_209039.1| hypothetical protein NGO2019 [Neisseria gonorrhoeae FA 1090]
    MTATEHDNDDALLLRYSRHILLDEIGIEGQQKLSAAHILVVGCGGLGAAALPYLAASGVGTLTIADSDTVELHNLQRQVA
    FDEGDVGKPKAETLAGRLKRINHTVDVRAVNEKLDGCRLTGLVQTADIVLDCCDNYATRQAVNRACVQTKTPLVSGAAVR
    FEGQLAAYRPDLPDSPCYACLFDGGSASDGI
    CSLFGVLSPLVGIVGCTQAAEALKILLEAGEPSHGRLAVYRALEGGWQY
    FDLPRNPECPVCGAAR

    >gi|59802366|ref|YP_209078.1| trifunctional thioredoxin/methionine sulfoxide reductase A/B protein [Neisseria gonorrhoeae FA 1090]
    MKHRTFFSLCAKFGCLLALGACSPKIVDAGTATVPHTLSTLKTADNRPASVYLKKDKPTLIKFWASWCPLCLSELGQAEK
    WAQDAKFSSANLITVASPGFLHEKKDGEFQKWYAGLNYPKLPVVTDNGGTIAQNLNISVYPSWALIGKDGDVQRIVKGSI
    NEAQALALIRNPNADLGSLKHSFYKPDTQKKDSAIMNTRTIYLAGG
    CFWGLEAYFQRIDGVVDAVSGYANGNTENPSYED
    VSYRHTGHAETVKVTYDADKLSLDDILQYYFRVVDPTSLNKQGNDTGTQYRSGVYYTDPAEKAVIAAALKREQQKYQLPL
    VVENEPLKNFYDAEEYHQDYLIKNPNGYCHIDIRKADEPLPGKTKAAPQGKGFDAATYKKPSDAELKRTLTEEQYQVTQN
    SATEYAFSHEYDHLFKPGIYVDVVSGEPLFSSADKYDSGCGWPSFTRPIDAKSVTEHDDFSFNMRRTEVRSRAADSHLGH
    VFPDGPRDKGRLRY
    CINGASLKFIPLEQMDAAGYGALKGKVK

    >gi|59802422|ref|YP_209134.1| putative thioredoxin [Neisseria gonorrhoeae FA 1090]
    MKKILTAAAVALIGILLATVLIPDSKTAPAFSLPDLHGKTVSNADLQGKVTLINFWFPSCPGCVSEMPKVTKTANDYKNK
    DFQVLAVAQPIDPIESVRQYVKDYGLPFTVIYDADKAVGQAFGTQVYPTSVLIGKKGEILKTYVGEPDFGKLYQEIDTAL
    AQ

    >gi|59802427|ref|YP_209139.1| RegF [Neisseria gonorrhoeae FA 1090]
    MMTLYSGITCPFSHRCRFVLYEKGMDFEIKDIDIYNKPEDLAVMNPYNQVPVLVERDLVLHESNIINEYIDERFPHPQLM
    PGDPVMRGRGRLVLYRMEKELFNHVQVLENPAAANKEQAKAREAIGNGLTMLSPSFSKSKYILGEDFSMIDVALAPLLWR
    LDHYDVKLGKSAAPLLKYAERIFQREAFIEALTPAEKAMRK