Nautilia profundicola AmH uid59345

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|224372123|ref|YP_002606495.1| thiol:disulfide interchange protein [Nautilia profundicola AmH]
    MKKLLLGLGIAVSLFASDKLLSQKELNNVLKSSIIYPKLSQDIKKGIVKVRGVEKDGFYIINIKTPRGSGNIYITKDKKY
    TILGNVLNNKNGTPLTANFPVNKKIVQNGVIFTFGKGDKEIYLVTDPE
    CPYCRMMEVKTKANLEKNYKVHVILFPLSFHK
    NAKAMSYYILAGKTDAEKAKRFREVLGGSNEWKNYHPTKEEKVKFDKILNNSKKAVEELGARGTPTVYDKDFNKINWTTL
    GEKK

    >gi|224372270|ref|YP_002606642.1| hypothetical protein NAMH_0218 [Nautilia profundicola AmH]
    MPQFDGNDRICPCKPAIEKEIPEDGVCHCGIFCSPEYAANYNKEHPKKEAREIEGLSVGELESILEKEQILGEELEILLK
    ARDAGLVDFALIDIREPFEYQMMRIKGTDELLPISRVQYDLDKWMKYKDKRIIIY
    CHVGSRSGYLQRALQQQLGFSKVGN
    LTYGIADYFGEVERG

    >gi|224372428|ref|YP_002606800.1| thiamine biosynthesis protein ThiI [Nautilia profundicola AmH]
    MLKYALPEYNKQIKISTQEARKLLENNKAVILDIRMPDEEDVLKHDFVLRLDPLKLEEHHIHLPKDKTILVVCNTQNRSP
    FAALYLREKGYDAKYIEKGIKELEKEFQKDVIKYENC

    >gi|224372430|ref|YP_002606802.1| hypothetical protein NAMH_0379 [Nautilia profundicola AmH]
    MLKYATPAGLKEIRTNIDEFLKLYKEDKAVLIDIRMPFEKKVWGLKFTIELSPEELEANLDKLPKDKLIVTACPGNGRSP
    YAAIYLKEKGFNAKYLEEGLIELMKKLKGAEAKNFLS

    >gi|224372493|ref|YP_002606865.1| thymidylate kinase [Nautilia profundicola AmH]
    MKFIIVFLLGVLTMANHLKLSDSPYLLQHADNPVDWYPWGDEAFEKAKKENRLIFLSIGYSTCHWCHVMERESFENEEIA
    DILNKYFVSIKVDREEHPDIDKKYQKIYQIMHNRAGGWPLTIIMTPKGDVFYSATYIPPHFSQLGPGLKEILASIVNDWQ
    NNPQKIENIAENLKEYLKNSKSFEKVKISDDILEKVISEALKSFDMKYGGMKGAPKFPMESSLDLLIDVYELSGNAHVLD
    LLNITFEKMAKGGIFDQVEGGFYRYSTDAKWEVPHFEKMLYNNANLPYEYLRMYEITENPLYREAAFRSLDEMIKRYRDE
    NFLFFSASNAESEGKEGAYFVYTYEEVKNAFKNLENAQELMEYFGIKKYGNFNSKNNPTLNGEKPENYKKALKILREIRS
    KREFPFIDTKKITAWNAMMVSALLKAGCLDEKYKTEGFKTLDELIEKMYINNTLYHSYNKNENAKTKALLEDYAYLVNAL
    IDAYEQSFDENYLYFAKDLINDAKEKFYKNRWYMNSSKDIEADFSDSAYASSLSVLAVDYIRLATLTYDIGLFEKGKEII
    DSGSYFIQKYPLYYPTITKAYFMQHYGTYVISMSEPECVNWEYPYIEIKKGENYELCSVEKCIIKTDKLNKIKDIIKKR

    >gi|224372538|ref|YP_002606910.1| sulfide dehydrogenase [Nautilia profundicola AmH]
    MKKLLVSLGLGAMLATSAFALSGPMAHIFKAEVKANAKYVKYITPQQLKKWMDEDKDFTVLDVREPAETAAGTVDWIELE
    KIPRGLVDVKAAVGYLKPNNTYVVI
    CKTGGRATLAGAKLVKQYGFKHVYVLKGGMVGWMKAGYTVVNKLGKFKAAQ

    >gi|224372590|ref|YP_002606962.1| alkyl hydroperoxide reductase [Nautilia profundicola AmH]
    MACEQDTKTAIKDEKITTKEEVSMEEIKTQEGVLVLKEMPEFKMEAYNAETGHYTEVSSEDYKGKWTVVCFYPADFTFVC
    PTEIAAMNAALPFLKELGVEVLAVSTDTKFSHKRFVETEPLLKDLKLTIGADPTGEVTRKFGVMIEGAGLALRGRFLINP
    DGVIVAQEVQAPPVGRSVKEFLRQIIAHQHAYKTGEVCPANWKPGKKTLPVNTDIEPMTGNVGAYVTLADLVDEADVKEM
    EELVKAFKEA

    >gi|224372604|ref|YP_002606976.1| Wp [Nautilia profundicola AmH]
    MKKLLVFLLLISSLFAVDWSGKINWAMNYNIAQSIAKSSDKLIMVDIALTTCPPCKYLAEKVYTDPEVSKYINDNFVAVF
    YLADQDSLPPTVQNYFTGSTPTILFLKPNGELVYSMIGARPPQAFLQIIKNVNNKYKGNK

    >gi|224372624|ref|YP_002606996.1| hypothetical protein NAMH_0579 [Nautilia profundicola AmH]
    MKLRHLALGLMVAGSFAYAHTFKLADTIKGMGPKVEALNKMCHSYEKYVNYITPDELKDWMKKDKDFTIVDVRSVDEMKG
    GEIDWPDYDEYPLGQVPVYAAMGAFKPNTVYVFV
    CATGHRAVIAGGQLVKWFGIPKKNVYVLRGGINGWLNTGYSVVNKV
    TEFGGFSKGLKAVEHPKEPIILDQF

    >gi|224372800|ref|YP_002607172.1| glucose inhibited division protein A [Nautilia profundicola AmH]
    MYDVILIGGGLNYAAAIVLSKAGKKVALIEKDLNHLGGTCLHNGCIPSKNLLHRAGSVIESKEEVFTKSAHLNLQKLQDK
    IKSRIQKSTKAVTAQCKAAGVKLIEGEAFVTDDGVEVNGEIIKSEYTIIGTGSYPRIPEGIKYDSKKIITSDEALNFKHV
    PKEISIYGTGAIGLEMASLFAALGSRVNLIYRHKNISKKFPPSITQKLETQLKTLGINLIPEFSIQKAFVKDNKVIIQSG
    DKILSSEYLLVAAGRVPDTNVVKTDKIRVSKGIETDEFFQTSMPNVYAIGDCNGKLLLAHAARAQALNVADQILGKKEKL
    NLDNIPKFIYTLPLSYANIGERSEKTAAFPLSYLGISGSGFGDENGEVILYADEEGFLCGADIFAPNAEELIGIIATALE
    AELDINTFKKVTFPHPTYSEAIDRALRKFK

    >gi|224372804|ref|YP_002607176.1| DNA-binding protein [Nautilia profundicola AmH]
    MKEKLQEIHTLIKNLQQNAPEETKNFFEFLKSVEKDGAVSAKNKELINIALAVAAQCEWCIAFHTQNAIKLGATKEEIVE
    AGMQAVLMHGGPALMYLTPLFNAIEEFGNE

    >gi|224372959|ref|YP_002607331.1| methionine-R-sulfoxide reductase [Nautilia profundicola AmH]
    MCECKNTLSDFEKYVICEKGTEPPFNNEYWDNKTPGIYKCRCCGTELFSSEHKFDSGTGWPSFYISIGPVLEQADFTGGM
    TRIEAMCGNCRGHLGHIFGDGPAPTGIRY
    CINSASLKFIPKYGDKSGS

    >gi|224372983|ref|YP_002607355.1| NADH oxidase [Nautilia profundicola AmH]
    MYDIVVIGGGVSGFVAAVNAKRFYPSKKVVVIEKNPKKLIPCGIPYIFDTYGIDDDLMHLEKKLKKFNVELITKEVRSFD
    VNSKVIMLSEASGESCASGSRAEKETGENNTDANDTNILKYEKLIIATGSKPFVPPIEGIENAYFIKKDYDYLKDLVSKA
    KNASDITIIGGGFIGLEIADELSKTKNVTLIEAMDSLLPNSFDTDFSESVKELLSKKVRILLNSKVSKITKEEVLVNSRT
    IKSDLTIVATGYKPNTEMFKDVLPLNPKGFIQADDYFRVSKDVFAIGDCVEHKEFFTSNPTPLMLASTAAFDARVAAANL
    YNLRIIRHNKDALNIYSTVIDSKTFAAVGITEKMAKEQGFDIIVAKTVTHSTHPPKFSHSTDVTLKLIFSKKDLYLLGAQ
    LSGGLNSAEIINILSLAIQKSATATDLYTMQIGTHPILTPPPTFYPISATAAEALKES

    >gi|224373122|ref|YP_002607494.1| methionine-S-sulfoxide reductase [Nautilia profundicola AmH]
    MPKAVFGGGCFWCLDAVFRKVDGVRDVVVGYAGGRRPNPNYEQVCTGVTGHAEVVEIDYDENTVSYDELLDIFFKIHDPT
    QLNRQGNDVGTQYRSIILYLDEEQKEKALKKIEELKKEGLNVVTEVKPLEIFYPAEKYHQNYFAKNPHQPYCMYVVAPKV
    EKYLKIKNENKKT

    >gi|224373165|ref|YP_002607537.1| thioredoxin 2 [Nautilia profundicola AmH]
    MSDIVIACPHCKSLNKLPKKDEYKKAVCGVCKGNLLENKAISVDSYDEFQKIVNSVTVPVIIDFWAEWCGPCQMFAPIFN
    KVAGSFPLQAQFIKVNTDKNQQAAMQFGIRSIPTIVALKDGVEIDRAMGALDEFSFSMWVDKIVES

    >gi|224373304|ref|YP_002607676.1| hypothetical protein NAMH_1283 [Nautilia profundicola AmH]
    MKKLFFLLLGVYLFASNLNWYSDYKKAFEVAKKENKYVMVDISKHDCPPCEFMKDTVMSGGDVVKILNSKFVLVEYYADA
    DDIPEKFRKHYFNFTPAILFYTNDGKFITGVYGATSYTHFLEELKKIIKG

    >gi|224373308|ref|YP_002607680.1| selenide, water dikinase [Nautilia profundicola AmH]
    MLKLNNEAKLTKYVRAAGCAGKLAPEELNDTTCVLGCSNENLLVGFEGNEDASIYKITDDIALVQTVDFITPVVDDPFVY
    GQIAAANSLSDVFAMGGDVKTALNLVGFDSCHHDREVLKEILKGGEDKIKECGGVLAGGHTIETPEMLYGLSVTGVVNPK
    QMIRNNTLKKDDVIILTKPLGMGILTTAIKADLVSDEVASEVAEILRTLNYKASIIAREIGVSAMTDVTGFGLLGHLYEM
    SGKKFTIEVEFDKVPFISEAINQASMGIIPAGSYNNQIFVEKYVEFVRNLSFEEQMILFDAQTSGGLLISLPQEKAEEYL
    KRAGNEGVFAKIIGNVKEKEEKFIKVI

    >gi|224373309|ref|YP_002607681.1| hypothetical protein NAMH_1288 [Nautilia profundicola AmH]
    MKVLFIFNREPYDGSDVAWNGLRLAKNMHGRGHDVRIFLMNDSVDLARDCNKKPDNYDNDLVAMLKEMYQDGVKLKVCGT
    CQARCGIYKNEPYFAPEIKATMNDLADWVEECDQVLTF

    >gi|224373310|ref|YP_002607682.1| periplasmic mercuric ion binding protein [Nautilia profundicola AmH]
    MKKFFIGLIFVSALFAAEKTVIIEVEGMTCPLCTSAIKRSLKTTPGVVKAKVLLSTKKATVVYDDAKTDTSKLLHAIEVV
    GYKGKVLEVKNEK

    >gi|224373311|ref|YP_002607683.1| hypothetical protein NAMH_1290 [Nautilia profundicola AmH]
    MVKRIDCKDLACPEPVLRTKDALEEMEEGILEVEVNSFSSVQNVKRFAQNQGLFTDTKKDGKNTVIRIVKGYECKLDLPP
    NGGNKESKSFWALIAGAVATAVLASMC
    CLGPLLFLMFGVSVGSLSFLHVFAPYRDYFTVAAVVIIAYLWWNWFFRLRKRP
    VCEGSICKNYVKYLSIGTVFVAIMLSYPYWAQYVLLGE

    >gi|224373329|ref|YP_002607701.1| formate dehydrogenase subunit B [Nautilia profundicola AmH]
    MYEYARMKFYCDEDRCIECNACTVACAEAHELPVGIHRRKVITLNEGIEGKEFSTSIACMHCTDAPCAQVCPVDCFYIRE
    DGIVLHDKDKCIGCGYCLYACPFGAPQFPRDGAFGVRGVMDKCTMCAGGPAPTNSIEEFELYGQNRIAEGKVPMCAAVCS
    TNALIVGDADSVAEIKRARDAAKGKGPMTPYGWDVAYK

    >gi|224373418|ref|YP_002607790.1| bacterioferritin comigratory protein [Nautilia profundicola AmH]
    MKAYDFCLPNQDGVEICLRDLKGKWIILYFYPKDNTPGCTTEAKEFSELLDEFEKLGAIVIGISPDSPKRHCNFIEKHGL
    EVTLLSDEEKEVLKAYGAWGKKKMYGKEYEGVIRSTFIINPEGEIVKEYKKVKAKGHAAKVLEDLKELINS

    >gi|224373479|ref|YP_002607851.1| glutaredoxin [Nautilia profundicola AmH]
    MSVKRVVLFTAPGCVWCTKAEQFFKKNKVKYRKIDISKDRKAAKDCERHGCRGVPVILIGSRWICGFNEPVIKRELGIK

    >gi|224373539|ref|YP_002607911.1| thioredoxin [Nautilia profundicola AmH]
    MALELNMQNFEDTIKNNEVVVVDFWAPWCGPCRMIAPIIEELAEEYKEKGVVVGKVNTDEAPEIAGQFGIRSIPTVIFFK
    NGEAVDAMIGAAPKQMYVEKIEALLS

    >gi|224373541|ref|YP_002607913.1| thioredoxin-disulfide reductase [Nautilia profundicola AmH]
    MHDVIIIGAGPGGLSAGLYAGRMGLDTLIIEKLTPGGQITQSSEIENYPGVCEVKSGLELMQCWPEQTMRFGAKIISEEV
    KSIEKNGDIFKVITSQNEYQGKAVILATGATPKRAGFKGEEEYIGKGVSY
    CAVCDGYFYKNMDVAVIGGGDSALEEALYL
    SNIAKKVYLIHRRNEFRASPLTIEKVMKKENIEILFNTTVEEVKGTPFLNTAVINQNGEIKELKVDGVFVFVGMNVNSSL
    VKDLCELNEYGEVKVDLNMKTTLDGLYAIGDVRQNSVKQVVASAGDGSVAALNVVKYVKNLKV

    >gi|224373587|ref|YP_002607959.1| electron transport protein [Nautilia profundicola AmH]
    MKHYELAVKFYKQKGPRHDKSLWAIRQKRDKAIKEVKEWEELRNKASGIKDYVIENLHSLVDEFIKNAENAGIEVVFAKN
    AKEHNETVLRYLKEINAKKVVKSKSMLTEECGLNVYLHDNGIEVIDTDLGERIVQLRGEKPSHIVLPAIHTTKEDVAEIL
    NETNTDPTYLTHKMRALLRKEFLSADAGLSGANFLVADKGWAVVCTNEGNADLGAVLPPLHIISVGIEKIVPNMKDLGVF
    LRMLARNATGQKITTYTSIFGKKDNGKRVIILVDNGRFERLKSQFKETLKCIRCSA
    CLTTCPVFRRSGGHSYRYVIPGPI
    GSLLAPLTDKEEYSDLPFACTLCGSCETVCPVKIPFTKQLVNMRHYVKSMDNEQWSMENAGMKLAEKAMHSPKMFKLFST
    ILRLTPKPLLESVAKEWSRYKALPAIPKERFIK

    >gi|224373608|ref|YP_002607980.1| arsenate reductase [Nautilia profundicola AmH]
    MKVYGIKTCGSVKKALKFFNENGIEYEFHDLKKEPVGCDKIDEWIKKAGIDVLFNNRGTKYRTLKLKELNLDENGKREWL
    CKENLLIKRPVIELDNGKVVVGFDEDRYKEIFA

    >gi|224373755|ref|YP_002608127.1| metallo-beta-lactamase family protein [Nautilia profundicola AmH]
    MLKKLIVGSLLSAGLLFAYNPLDGVKAQKAEALKIVGNNFVTVKTLKTWIKEGKVKIVDVREGPEFLAGHIKGAVLIPRG
    VIYGAVKKGKIKPNQRIVTV
    CRTGHRALLAAATLKKWYKFDNVYVLKGGMKAWIKNGGVVVNAMKLGPVKINLISK

    >gi|224373791|ref|YP_002608163.1| thiol peroxidase [Nautilia profundicola AmH]
    MPTLTKLKGNDVALYGNQVNVGDSAPVVTLPNSGLEEVTIGGAQDKAQLIVAVPSLDTPVCAMETTKFNNQAANVEGATV
    YVVSMDLPFAAKRFCSTEGIENLQVLSDFRDKCFSAAYGTLIAEGPLRGLSARAIFVIGKDGKVVYKELVEEITAEPDYE
    AALAALKEAAAK