Natranaerobius thermophilus JW NM WN LF uid59001

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|188584777|ref|YP_001916322.1| thioredoxin reductase (NADPH) [Natranaerobius thermophilus JW/NM-WN-LF]
    MTDQFDRENIYDVAIIGSGPGGLTAAIYATRAGLKVLMIERMAPGGQLLNTEEVDNFPGFPDGTTGVELAQKLEKQARRF
    GTELKMGEVIETNLSGSEKMIKTRDEVYKAKSVIIATGESPTELSAPGEQNLKGRGVSY
    CAICDGAFFKNKNVAVVGGGD
    SAVESALYLSRLASQVTLIHRRDQLRAVEYLKKRAIDCENLEIKYNTVVKEIQGEQKVESLLVEDVNTQARETLNCQGIF
    VYVGAHPNTDFLSNQLDLEDGYLVTSETMETNLKGVFAVGDVRKKELRQIVTAVSDGAIAAFHAEKLLS

    >gi|188584778|ref|YP_001916323.1| thioredoxin [Natranaerobius thermophilus JW/NM-WN-LF]
    MSKILEVNDTNFKEQVLEADKPVLVEFWAPWCGPCKMVAPVLEELAEEMDGKIKICKVNVDENTDTASDYGVMSIPTMVL
    IKDGEVQEQVVGYLPREELQNKIEENI

    >gi|188585066|ref|YP_001916611.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Natranaerobius thermophilus JW/NM-WN-LF]
    MAKKVIIIGGNAAGLSAASQIKRQNPHWDTIVFERTDEVSYASCGIPYYIQEQVTDSSNLYALSANKLKQDRGIDLRLHT
    EIMKINPEDNKVIYNSKDCQNNLLEESYDYLLIATGTSPDSKGITINSDKVFSVKYVGDGVRIKNYLKQQTPKKVAVIGG
    GYIALEMAESLKNLGLDTYFIHRRDQLNRAFMPDISQEALQVLEQNNVNLLLNTEVTKIEDKSNNKVAVTTESGNSLEFD
    MIITAIGVRPNTSFLKESGIELGVNDTIKTSRYMQTNYSNIYAAGDVAETVNLVTQKSVFSPLALKANKEGSIAGSNIAA
    EAHVEKFPGVLKTSILKLFNTGIARTGLTENEANQEGFNAETIVIDSPNKPGYYPGSRKLKTVIVFESKTGKLLGAQLIG
    PIEDAKKIDTFAVLTQTGATVDDIYHLDLSYAPPFSPVYDPVVLAGRVARKQSQKS

    >gi|188585109|ref|YP_001916654.1| thioredoxin reductase [Natranaerobius thermophilus JW/NM-WN-LF]
    MSDVFDVLIIGGGPAGLTAGIYASRSKLKTAILEKKRKPGGQMSTTWELENYPGFKEATGPDIAKSLSEHAEKFGCEFLK
    GEVKEIDLHSNPKVVTSKKGEEYHAKSVIMATGAEPRTLGLPGEHEFRGLGVGY
    CATCDADFYTDQEVIVIGSGDAAVEE
    AIYLTRFAKKVTIVVVHEEGKMDATKVIQERAFENPKIDYIWNSVVEEIKGDELVDRVVVKNIKTGETSEVKTDGVFIFV
    GTIPKTEFIEGQVELTEQGYVKVNDQMETSVPGVYSAGDVNDKFLRQVVTACADGAIAATACERFLEERQDIEEKIEEPS
    QEKSVIVVFWSPTVKESMEAISQLEEVVGNDNQVKIVNIDTYKSTGIADNYQINEIPSIIAVRNKKVVASLTGKEVNKEK
    LADFYQDLV

    >gi|188585110|ref|YP_001916655.1| Thioredoxin domain [Natranaerobius thermophilus JW/NM-WN-LF]
    MQEVDKNNFEEEVLQAEGVVMVDFFSPNCEPCNELKPEIEDMAEKYKDKMKFCALDISKNRRLAINQKVLNLPTIVFYKD
    GEKISTLTGEDLEAEEIEDEVKKHI

    >gi|188585112|ref|YP_001916657.1| Betaine reductase [Natranaerobius thermophilus JW/NM-WN-LF]
    MFEGKKVVILGDRDGIPGPAIEECIKTTGAEVVYSTTECFVCTSAGAMDLENQKRVKELTDKHGPENLIVIIGGADAEGS
    GLATETVTNGDPTFAGPLAGVQLGLKCYHIVEPEVKEAVDSSVYEEQVEMMEMVLEVDEIIQEVKEYREKYCKFL

    >gi|188585113|ref|YP_001916658.1| selenoprotein B, glycine/betaine/sarcosine/D-proline reductase family [Natranaerobius thermophilus JW/NM-WN-LF]
    MSKKIVHYINQFFGQIGGEEKADTAPFVKEEPVGPGTALNGQLGDEGEIVATIICGDDYFSSNTEEAKEEIRKVLRDYDP
    DLVITGPAFNAGRYGTAAGGVAELAATEFELPVVSGMYPENPGVDMYKKYAYIIETSDSAAGMRKAAPAIAELSKKILRG
    EELGTPKEEGYIPRGIRKNVFFEERGSKRGVDMLVKKLNQEKFDTEYPMPDFDRVDPQPAIKDMANAKIALVTSGGIVPK
    GNPDGIESSSASKYGKYELKGMDTLTAESHETAHGGYDPTYANENPNRVLPLDAARKLEQEGRIAELHEYFYSTVGNGTS
    VGNAQQYAAEIAEDLKNHGVDAVIQTST
    CGTCTRCGATMVKEYERAGLPAVHVASIVPISKTVGANRIVPAVAIPHPLGN
    PKLDEEEEFKVRKDLVDKALKALETELETQTVFED

    >gi|188585136|ref|YP_001916681.1| electron transport complex, RnfABCDGE type, E subunit [Natranaerobius thermophilus JW/NM-WN-LF]
    MKFSEAFTQGLLKENGLYRQLLGLCPALAVTQTAMNSLGLGAATMAVLLAANIVISLVKNLIPKKIRIPSYIVIIATFVT
    IVDMFLEAFTPDLHAALGIFIPLIVTN
    CLILGRAEAFASKEKVTSAIGDALGMGIGFTLGLLSLGVVRELFGKGSLFGWP
    VLHELFGAFGLEFQPALIFIQPAGAFFALGILLALMNIVYKRLQYD

    >gi|188585137|ref|YP_001916682.1| electron transport complex, RnfABCDGE type, A subunit [Natranaerobius thermophilus JW/NM-WN-LF]
    MEELLAIFIGAIFVNNIVLIQFLGICPFLGVSKKVETAVGMGLAVTFIMTLASIITWLIHEMILVPFEAEYLEYVAYILV
    IASLVQFIEMLLEKVSPNLYKALGIYLPLITTN
    CAILGLALQNILEGYNLLESTIHGVGAGIGFTVALVVMAGIREQLEF
    AKMPNLFQGASVAFIIAGILSIAFTGFLGVI

    >gi|188585290|ref|YP_001916835.1| SoxR-reducing system protein RsxE [Natranaerobius thermophilus JW/NM-WN-LF]
    MLLEAYSPALQKSRGIFVPLIVTNCLILERSEAFASKKKSVHLLVMLASVPFIIAGVLSIAFTGFLGVILVLNPDSILKK
    TRGLPL

    >gi|188585385|ref|YP_001916930.1| redox-active disulfide protein 2 [Natranaerobius thermophilus JW/NM-WN-LF]
    MKIKVMGPGCKNCETVFNRVQEVIKEKGVEADVEKVTDMNEITNAGVLMTPGLVINDEVKISGRVPSKEEIGEVIDSA

    >gi|188585540|ref|YP_001917085.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Natranaerobius thermophilus JW/NM-WN-LF]
    MNPEEQQKFRVIIVGSGVAARSAIQSLNLYKNLDITVIRRDDHQIVPCAIPYTFKRLQPSDIIGDDKNWDTLDARIINDE
    VVNIDRENKMLRLKSGSSYSYDRLILATGANPIKPPIKGMNKENVFFVEKNARQISELQEKAASSGRVVIIGGGFIGVEI
    ADELSGSGKDIHLIETEHRLLPKAFDSKISDRVEKILGEQGVTVHTNKFVTEIKSNKIVMSGQDKSGEYELATDMVICAI
    GVTPNSELAEASGIAVNSADKGIIVDDYYYSSDPNILACGDCISKRDFNSGGESGVRLASTAASEGKVAGFNIFNRRFPN
    NKGVINLFNTKIGDTSFAAAGITEFEAKKKGCPVVSIDGNFPDRHPTKFSDVTTNYVKLIFNSFNGKLLGGQVQGSKSIG
    EFINTVGLAIQHELTAYDLASVQYATHPLLTTGPSGYPLLKLSIEAIRNLTGNEN

    >gi|188585586|ref|YP_001917131.1| protein of unknown function DUF255 [Natranaerobius thermophilus JW/NM-WN-LF]
    MPKENMHGTVNRLANEKSPYLLQHAHNPVDWFPWSEEAFEKAKKEDKPIFLSIGYSTCHWCHVMEQESFEDHEIAGILNK
    NFISIKVDREERPDIDAIYMSACQALTGRGGWPLTVFLNHDKNPFYAGTYFPKENRLGMPGLKDILEKVSSKWQNDRYEL
    INIGNEITQAVEHHFFTHAPGNVTEESLHIAFSQLEENFDEEYGGFGSAPKFPSPHNLYFLLRYYHLTGNESALHMVKKT
    LTSMYRGGIYDHIGYGFCRYSTDKKWLVPHFEKMLYDNALLAIAYLEVYEITRNNFFKEIAQEIFTYVSRELTSPEGGFY
    SAEDADSEGEEGKFYVFTPQEVIEVLGEVRGQEFCKQYNITANGNFEHGNSIPNLIGKNPEKDEFQKDLKKLFEYREQRE
    HPFKDDKILTSWNGLMIAALAKGSRVLNDERYLNMAQSSYRFIEKNLITNNQRLLTRYRDGEASIPGFLDDYAYLVWGLI
    ELYNASFEPYYLEKALIFNDEMIKLFWDQDQGGLYLYGHDSETLVSRPKEIDDSALPSGNSVATRNLLELFHLTGKTSLE
    ELAERQINSFGGSVNKSPIYYTHFLTAVYLVLTTTEEITVVSDPEPDEATSVLVEALIKGFHPNRFLLVKTEDRKGRQLE
    ELAPIVNNRNQKDNKPTIYVCKDFTCLTPVHSLEEISQQLKIESKF

    >gi|188585711|ref|YP_001917256.1| electron transport complex, RnfABCDGE type, E subunit [Natranaerobius thermophilus JW/NM-WN-LF]
    MNFSQALAQGILRENGLYRQLLGLCPALAVTGTAINSLGMGVATLSVLVASNIVISLIRNLIPQKIRIPAYIVIIATFVT
    LVDMVLEAFNPELHSALGIFIPLIVTN
    CLILGRAEAFASREEIVPSIGDGLGMGLGFTLALLSVGVVRELLGMGSIFGWP
    VMDQLFGLFGAEFQPVLIFVQPAGAFFALGLLLAVMNLYFRKISV

    >gi|188585712|ref|YP_001917257.1| electron transport complex, RnfABCDGE type, A subunit [Natranaerobius thermophilus JW/NM-WN-LF]
    MIEDLLVIFLGAVLVNNFVLIRFLGICPFLGVSKKVETALGMGFAVTFVMTLSSIITWFIAEFILIPLEAEYLEYVAYIL
    VIASLVQFIEMLLEKVSPSLYKALGIFLPLITTN
    CAILGLVLINILEDYNLLEATVHGIGAGVGFILALILMAGIRERLE
    LVKMHEVFKGASIAFITAGILALAFSGFLGII

    >gi|188585719|ref|YP_001917264.1| UBA/THIF-type NAD/FAD binding protein [Natranaerobius thermophilus JW/NM-WN-LF]
    MLETITEKWGELMNFNEAQLERYSRQIILSEVGVEGQQKLLDSKVLIIGTGGLGAPAAMYLAALGIGTIGLVDGDKVELS
    NLQRQIIHQTKDIGKLKAESGKETILHMNPDVEVIPHNTWINSQNIQDIIEDYDFVIDGTDNFAAKFLINDACVMSEKPF
    CHAGIIRFQGQVMTYVPNGNGVTPCYRCVFNEPPPDGVVPS
    CQEAGVLGLLGGVIGGLQATEAVKYLLGIGDNLTGELLV
    YDALKMDFRKIELHSDRDCKICGTNPEIKDLVDYTGPKCNLQTK

    >gi|188585724|ref|YP_001917269.1| copper ion binding protein [Natranaerobius thermophilus JW/NM-WN-LF]
    MANCCGGNNLENITLKVEGMACEHCKKAIEKELNNLDGVDKAEVELSKGQVDVSFNPDRVTKEDLVNAITEAGYQVR

    >gi|188585789|ref|YP_001917334.1| OsmC family protein [Natranaerobius thermophilus JW/NM-WN-LF]
    MKSKIIWKDNMAFYGEGENSTNQVVFDATSGVGGNEEGPCPMEMLLISLAGCASMDIMTIIRKRRKEIEEYWVEVSGERR
    DEHPKIFEKIDMTFHVKSKDLTEKELVRAIELSESTYCSVWSSFDPDKTEITYDYVIHPPAEE

    >gi|188585889|ref|YP_001917434.1| Redoxin domain protein [Natranaerobius thermophilus JW/NM-WN-LF]
    MFLKKSLLIILLLVLMTGSFLLSGCNPDILLDDEKEAKEEEEKETNDFEFEGTDDDLDEVEFEVSSHTLQNLDGDEVTVP
    DDLEDIVLIKFWQST
    CPLCLEEMDATQKLHDQVKEDDDMGIYTINVMEDPDEITSFMENEGYKFPVLFDSDGDMTEDYQV
    VGFPVQYLVNQDQEVLFVKPGPMTFEEMESLLQQK

    >gi|188585904|ref|YP_001917449.1| methylated-DNA--protein-cysteine methyltransferase [Natranaerobius thermophilus JW/NM-WN-LF]
    MFKKMLYETKWGTITFGHNQGIVNRVILPDKQEETGLEEELSSYQNQKLTALERELNLYFQGRLVNFSIPVSLEGLPTFT
    KQVLEVTKRVNWGEVCTYGQIAKILNKPGASRAVGQSLGKNPCPLLVP
    CHRVIGRNNSLGGFSGMIELKKWFLNLEGVNL
    KVLKEV

    >gi|188586464|ref|YP_001918009.1| NADH:flavin oxidoreductase/NADH oxidase [Natranaerobius thermophilus JW/NM-WN-LF]
    MNNKYASLFEPMKIGKTKIKNRIGMSPMAASGMITPHNCFDKRAAEYYVERARGGAGLIITGGVEVENEIEQTKLGIFQN
    ISTNPVAFALNSSEMIERVHAHGSKIFLQLTMGFGRSLFLDFVDSHPVAPSAIPHFWEPDVTCRELTTNEVEYMVEKMAE
    AAKVAASAGYDGVEVHAMHEGYLLDQFTLKAFNKRTDKYGGDLRGRLQLPIEILQAIKSEVGQDFPVILRYGVKSCIKAP
    HQGGLPGEDYQEHGRDLEEGLEAAKILEEAGYDGFNADLGSYEALYWAHPPTYIEHGCYLPYTKQLKEVIDVPVLTAGRM
    DNPEVAAEAVTSEKTDMALLGRGLLADPDWPNKVKSGETDKIRPCLGCHDGCMGRLESGKVISCAVNPACGREEEYKLHP
    PLKQKDVMVVGGGIAGMEAARVAAIRGHKVSLYEKNNSLGGHVVEASVPEFKKDERELLRWYGQELKENDVELNLGTEVD
    SQLVKEINPDEIILATGAKEKIPPIQGIDQDHVLTA
    CDALMNPDKVGKNVAIIGGGLVGCEIAIWLAQQNKQITIVEMIE
    ELMGAVFVSHANEMMLKDMIKHEGIEVKTDTSLLEVQENEIVTINKEFKKQNLNADTVLLAIGYESDTKLYEELKDIHPK
    THLIGDARTVQNIMYGIWEGYEVARTL

    >gi|188586486|ref|YP_001918031.1| heavy metal translocating P-type ATPase [Natranaerobius thermophilus JW/NM-WN-LF]
    MTTSEKASIQIIIEGMNCASCVKQVEKEIEDLVGVYEASVNFATEKALVKYNPREVSEGDLLTAVERAGYHGELLPEYGE
    KSKAKKKSGDNHEHNFQTGDKGKKSVKQAFGWEEADLSISGMT
    CAACQQRVEKGLNELEGVSATVNLSTEKARVTYDPSI
    IDLLSIKEAVSKLGYEAEEVKELQGKGGASIAEESQAEKKLKKAAWRMWLAVAFAGPLMILMMIHMFLIQIPYYFALSAV
    LGFPAIFIAGSETHKSTLKNLRRLNANMDTLVTLGSTVPYMLSFLGIWFPITTFIEMAATILTLHLVGRFLEAKAKGRAS
    EAIKRLLAMEAKEARVIRDGEKLSIPVDQVEPGDIMVVRPGEKIPTDGRVMEGNSFVDESMATGESLPVERKAGDEVIGA
    TVNKQGALQVKATKIGKDTFLSQVIKMVEEAQGSKVPIQEFADRVTGYFVPAVLIIALSAFIFWLIIPSFFLGIITAAEQ
    YLPWVNPDAPQFTLAFLAATAVLVISCPCALGLATPTALMVGSGKGAEQGVLIRNGEAIQMMKDIKMIAFDKTGTITKGK
    PEVTDIVSTSSYSTQDILFYVGSLEASSEHPLGEAIVVKARQEAEKQNFNLAQAEEFSAITGQGVRGLVDGQEVLVGSRK
    LMESKGIDINQIEREMEKLENKAKTAMLVAISGNLAGIIAVSDTLKEDSKEAIREIEEMGLITCMITGDNQRTADAIARE
    VGISRTVANVLPDEKVNEIKSLQKQYGMVSMVGDGINDAPALKQSDVGIAIGTGTDVAIEAADLTLIRGDLSAVVSGIKL
    SRATFRKIKENYFWAWFYNAIAIPLAFFGLLHPIIGAAAMAFSSLNVILNSTRLKKNRYFLRFCYF

    >gi|188586742|ref|YP_001918287.1| 1-Cys peroxiredoxin, 3-Cys thioredoxin peroxidase [Natranaerobius thermophilus JW/NM-WN-LF]
    MTFNENQNTMPLLGDKFPEVDVQTTHGTLKLPQDYKGKWFVLFSHPGDFTPVCTTEFVSFAQKADKFKELNTELIGLSVD
    QVFSHIKWVEWINENFDVEIPFPVIADEMGELSKMLGMLHPNKGTNTVRAVFVVDDKGVLRLMKYYPQEIGRNIEEILRS
    IKALQTHEKNQVALPENWPNNETLGDKVIIPPASTEQEAKERKKQAEAGELEYKDWWFCYKNL

    >gi|188586743|ref|YP_001918288.1| Thioredoxin-disulfide reductase [Natranaerobius thermophilus JW/NM-WN-LF]
    MSNTNTEIAIVGCGPAGLSAAINVKARNKTSLIFGTEVCSPKLQKAPHLHNYLGFFDITGEEFQKRALKQVEHYGIEMLR
    SSVDSIFPLGDGFDLMVKDEVYHAKVVILATGVTQGHVLPGENEFLGKGVSY
    CASCDAPIFKNKTTAIIAEVKEAEQEAE
    LLSELCEHVYYIPQYREEIQVNDGVEIIQDKPKAILGKNQVTHLQLKNQRIECDGIFIIRETVPASQLVQGLETSGSAIK
    VNRDMSTNIEGLYAAGDITGWPYQLGKAVGEGQVAALNAVDFISQQKKND

    >gi|188586777|ref|YP_001918322.1| Methyltransferase type 11 [Natranaerobius thermophilus JW/NM-WN-LF]
    MKRKVINWKWEDSEAQKSFIEWQGFPSDEDSLKEVEEAEGLTGIRPGAKILDLGCGNGRHAIELAKKGYSVVGIDVAELY
    LEEARKRSQKEGLQIEYRLQRGSELTETDEYDMIFAYNHTLGFMSPEELMDHFAKIYKALKPQGVFFLKTAGPQIKPDQT
    TDQEKDWAEQEDKFIMSEKSIVDGYRYEK
    CIVIDLTKEEIIEYREKQRAFSFEEVKNVLTEAGFSKIDSYKDLQGNQANR
    NEFGVYICKK

    >gi|188586787|ref|YP_001918332.1| alkylhydroperoxidase like protein, AhpD family [Natranaerobius thermophilus JW/NM-WN-LF]
    MNDPKQLLNEFMEGLQSFEDEAPEQTQAFMNLLGASYKDEALSNKTKELISVAIGAYNRCEYCIAFHVYKALEAGATKEE
    IYESAMVSVAFGGGPSMAYSVTLVKKSVEAFLPEFQS

    >gi|188586789|ref|YP_001918334.1| dihydrolipoamide dehydrogenase [Natranaerobius thermophilus JW/NM-WN-LF]
    MDFLVKIPKLNQKSNQVTVYQWFIQEGEEVKSGDPLLEVTSDKTNVRVEAEVNGTVKEIMVSEGEKAKLNQAVCKLETTE
    TVSKDKPKSSPKDKDTSKTSGSDESQFNYFGSLLGKKEPEKESKEVDLCILGGGPGGYTAAIRAAKAGLSVALVEKDNLG
    GT
    CLNRGCIPTKALIQSANLLSQINSAENFGITTDAVIGDFSKAVSYKDNVVTTLKDGVANLLANNQVSVISGEGQLKSS
    TEVTVEADNKIVNITAKNIILATGSKPKLPPIEGIEHENVLTSTELLNLKELPSKMVIIGGGVIGMELSFILNKFGVDVT
    VVEAMDHILPYMDKQIGEEIKISAEEQGINIITGAFAKEISQVENGGLMITLTKNEEQLKVFGNQILVAIGRDFNTKALN
    ATELGLDTTKQGAIQVDKHLKTSLDNVYAIGDVIGGYLLAHEASHEAIVAVDNILGIEKQINYDNIPSAVFTDPEAAQVG
    LTQKEAKDMGYQVKTAEFPFSSNGKVLTTQKLSGFSKLVVNSTDNVILGGSLVGVGATELIHQIAIAVTNQLTVEQLTNT
    VFAHPTVSETIFESSLAFFGEEIHG

    >gi|188586948|ref|YP_001918493.1| glutaredoxin [Natranaerobius thermophilus JW/NM-WN-LF]
    MSEKVELFTTPTCPACKQVKSYLEEQGVDYVEHDISQDDEARKRMAEETGQMVVPIAKIGDDYIVGFDKEEYDRLLQL

    >gi|188587042|ref|YP_001918587.1| conserved hypothetical protein [Natranaerobius thermophilus JW/NM-WN-LF]
    MLLGNPDNMGFCIACFLRDIAGSLGMHQASVVQYIRPEVIGLILGAFIISKANGEFRPTAGSATATRFLLAVFIMFGALI
    FLGCPLRMVLRLAGGDLTSLPAFLGFIVGIIIGTEFLKNGFNLGRSYRQSSFEGYIAPLTSVVLLLLLIMAPGVLIFSQE
    GPGSLSAPIVVSLIAGLVGGALAQRSRLCMAGGIRDIYLIRDFTLFTGFIFIFIVALVFNLIAGQFQLGFEGQPVAHTDH
    LLSFLGMALVGICAILLGG
    CPLRQLILAGSGDGDGAVAVFGMIVGGALAHNLGVAASPEGVSTEGIITLIIGFIFVLVTA
    FMNMETIGLSSSSKVRQ

    >gi|188587068|ref|YP_001918613.1| heavy metal translocating P-type ATPase [Natranaerobius thermophilus JW/NM-WN-LF]
    MNNTTLKLTGMTCANCAQRIEKQLNKTQGTNSAQVNFAVEKAYIEYDPTQISEDDLIKIVQDSGYDAKSEEQDEKNKKNV
    ELKISGMT
    CSACSQRVEKNLNKLDGVHANVNIATEKATITYNPTKTSLNSLKQTIRDTGYDIVDEELEQEIDPEEEKIKE
    AAERMWWSVGFASVVMIIMMVHMFVTPIPYYIPIISVLGFPVIFIFGRKTHQATWRALKNGSPNMDTLVTMGSAVPFILN
    FLGIILGLPITSFIEMATTIMAFHMIGKFLEIKAKGRASQAIKKLLEMEAKTARVIRDGEEKEVPMEEVQVGDVMVIRPG
    EKIPTDGVVVQGESSIDESMATGESIPVNKTVEDEVIGATINKQGILHVEATKIGKDTFLSQVIKMVEEAQGSKVPIQEF
    ADRVTGYFVPGVILIAIAAFISWMVFPDFHVSVVEYFDFPWSTIDLPQLSLALLATIAVLVISCPCALGLATPTALMVGS
    GLGAEKGVLIRKGEAIQTMKDINIIAFDKTGTITKGKPEVTDVINYNGFSREDILLYAGSLEASSEHPLGEAIVETAKEE
    NITFQQVENFSAITGKGVRGEINNKEVLVGSRKLMAEKDIEHQHLNSELERLEDEAKTAMLVAIDGKMAGIVAVADTLKE
    DSIQAIEEIEQLGMKTAMITGDNERTANAIAKKVGISSVLAEVLPDGKVDEIKKLQDEYGNVAMVGDGINDAPALKQANI
    GIAIGTGTDIAIEAADITVIRGDLSAVVSGIKLSKATFKKIVENYFWAWFYNAIAIPAAFLGLIHPIIGAAAMAASSINV
    VLNSTRLKKAKVDPSYDREDLKGSHHKGEQSLEAKV

    >gi|188587070|ref|YP_001918615.1| heavy metal translocating P-type ATPase [Natranaerobius thermophilus JW/NM-WN-LF]
    MKYYLRGLDCPSCAAKIERKLNNLNPNPNQEININLNNNTVELDPELYEEAQKIVDDIEPGVKLIPKENNKEQPHNNYED
    DHSSNLKQEYLKIIISLGLLIFGFIFREELQNTPWAIADYSVFLIAYFLVGGHVVISAVKNLVRRDIFNEKFLMTIATLG
    AILIQELPEAVAVMLFYAVGELFQDLAVNKSRRSISSLLDLRPEFANLITEKGTEQVSPEQVTPGDVIEIYPGERIPLDG
    KVLSGESYINASALTGESVPESVGPGEQVMAGTINENNLLRVQVTKEFNNSSVAKIFDLVEKAAERKAPTEKFITTFAAW
    YTPVVVGGAAVLATIPPLLIPGAEFSEWIYRALILLVISCPCALVLSIPLGYFGGIGGASRGGILVKGANFLDALIDADT
    VVFDKTGTLTEGTFQVVKINPKNGFSDQELLNYASTAEIYSNHPIARSILHEAKHKFNFSREELKAKVLKQREDKGFGVK
    TTLSDGSVILAGSEKLLTKESINMDLTDEKDNGETIVHVAVDDKYVGYLILDDEIKADAAEIVAKLKAKGVSHTVMLSGD
    EEQTAKRVAKQLNIDKYYAGLLPEEKIEIMDELIANKTGDEKILYVGDGINDAPVITRADVGIAMGALGTDAAIEAADIV
    LMDDNLDKIPLSLDVARKTRRIVLQNIVFALGVKAAFVSLGALGMATMWGAIFADVGVALLAVFNSTRALRTPGKLSQYN
    SDSE

    >gi|188587260|ref|YP_001918805.1| CoB--CoM heterodisulfide reductase subunit A [Natranaerobius thermophilus JW/NM-WN-LF]
    MRIGVFICWCGSNIKNMVDVERVAQEAKRMPRVVYSQDVQYLCSEVGQADIRDAIAEHNLDRVVIGACSPRMHEPTFQKL
    LEEQGLNPFYVEIANIREQCSWVHSDKDKATEKATELVQKAVAKSYHSIPLTSDLLDVNKRALVVGGGIAGIQAALDIAE
    AGYPVDLVEKEPSIGGRMAQFDKTFPTLDCSA
    CILTPKMVEAASHENINLYTYSEIEDLSGYVGNFKVRIKQKAKSVKPD
    KCNGCGDCMAKCPKKVDNEFDEGNSKRKAIYTLFPQAVPNKPVLDRENCIYFQTGKCGVCQKICPTGAIDYEEQDEIIEN
    EYGAIVAATGFDLKKPVELGEYCYGDHSDVITSLELERMLNASGPTGGKVVRPSNGETPKRIAFIQCVGSRDRNEGNPYC
    SKVCCLYTAKHTLLMSEKFPETENFVFNIDVRTAGKDYEEFYERARQQGANYLRGQVSKVEPLEDDNNRLLVRGYDSSLG
    EQVEIEADLVVLASSIEPKPDSQDVATVLGISVDQNGFFSEAHPKLRPVETQAQGVYLAGVCQGPKDIPETVAQASGASA
    KVITLFNKGQVKSVPTTAIVNTDICSGCMQCKTVCPYEAISQDHVEEKVAGEVRQRPVASVNRALCQGCGACAGLCRSGA
    MDLGGFTSKQLMAEVDTL

    >gi|188587341|ref|YP_001918886.1| dihydrolipoamide dehydrogenase [Natranaerobius thermophilus JW/NM-WN-LF]
    MEQVDLLIVGSGPGGYVAALRGAQLGAQVMMVEKDEIGGTCLNRGCIPTKTLHKSAELFTEMKKADEFGFQIDNINLDYQ
    RVSDRKEEIVGNLKDSVKKLLKKAGVQTVFGRCELKADKEAEVDLHDGSKMEVKANSVIIATGSESATSDLPGSDHKDVI
    GTDEILEMRELVDDLVVIGGGVTGVELAGIMSEFGVNVSLVKRTPYISPVDDDIAKRLFSILKRAGVNVMTQSQVKEIRE
    HDGEKSLEVVVEKKGKEQRVPADKVLISRGRKPHLDGLEALDLEIGEDGIQVNEKLETNIPGVYAIGDAASQGAMLAHVA
    HHQGVLAAENAMGEERTYDDKAVPNCVFTVTEVASVGENEASLKEQEIPYKVGRFPFGANGKALAEGKIDGQVKILSHQE
    TDQVLGVHIMGPHASDLIQEGTVAVKEGLKTADLGELIHPHPTLSETLWEAALDSLDMPLHQLPKKKKK