Nakamurella multipartita DSM 44233 uid59221

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|258650371|ref|YP_003199527.1| Methyltransferase type 11 [Nakamurella multipartita DSM 44233]
    MATVDEDLRDQVRDRYARAALAVTAPAGAADCCGGGCGATVLDDPDAPFGAGRYEPEQTSELPPEAVLASLGCGNPLAVA
    ELRAGERVLDLGSGGGIDVLLSAKRVGPTGFAYGLDMTDEMLVLARANAAKAGAANVEFVKGHIEDIPLPDAAVDVVISN
    CVINLSVDKPAVLAEMFRVLAPGGRIGISDVVAEDHLSVADRAERGSYVG
    CIAGALSRQEYLDGLAAAGFVDADVTFTHE
    AAPGLHAAIIRARTPRPAGS

    >gi|258650380|ref|YP_003199536.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Nakamurella multipartita DSM 44233]
    MTSPEPARKAADLAGESDVYDVVVIGGGPPGEIVAQYAIADSTRTAVIVEHELLGGECSYWACMPSKALLRPVELLDAAR
    HMPGVASLVAGRTIDVPAVLERRDGFTSHHDDKYQVQWANDTGIGVVRGHGRLAGPKQVEVTGADGATRIITARHAVVLA
    TGTTASVPDLPGLRAALPWTSRDVTNLHEVPRRVAVVGGGVVACESASWLHGLGVQELTILVRGGGLLDRNEPFAGELVA
    QAFRDAGVKVLLHTGLDEVRRADPAATGEGRTHGGEVTLRFGDQTLVVDELVVAAGRTPASADLGLDAVGVDVGASHGFV
    TTDDQLAVRGVDGQWLYAVGDLTGRALLTHMGKYQGRICGAVIAARAEGRPTDGSRFTDLADDGRVPQVTFTDPQVASVG
    RSERQARDAGLDVEAVEYDMAGFAGSSLLRDGYVGRAKLVIDRTTDTLIGATFVGAEVAELVHAATVAVVGGVTLEQLWH
    VVPSYPTMSEIWLKLLEARSAGKAH

    >gi|258650382|ref|YP_003199538.1| Heavy metal transport/detoxification protein [Nakamurella multipartita DSM 44233]
    MSENTARYRVTGMTCDQCVVAVTEEVRRLEGVRSVDIELRPGDISVVTIVSDAPLLAGAVRDAIDEAGYALAS

    >gi|258650478|ref|YP_003199634.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Nakamurella multipartita DSM 44233]
    MDSFDLVVIGSGPAGQKAAIAAAKLGHRAAVVDRGHMMGGVCINTGTIPSKTLREAVLYLTGLSQRELYGEAYRVKEDIT
    IGDVASRIAHVVNREVDVVRNQLTRNHVVVLPGTATFVDPHTIRVAAADGTSRLLRGEKIVIAAGTKPARPDSVDFDGET
    IVDSDQILSIDKVPASMVVVGAGVIGIEYASMFAALGTKVTVVESRATMLPFCDDEIIEALKYHLRSLAVTFRFSETVLE
    VQKHPAGTLTVLQSGKKIPADTVLYSAGRQGVTDELNVQAAGVPASNRGKVEVNENFQTEVEHIYAVGDVIGFPALAATA
    MEQGRRAAYHAFDEPVGKLGDLQPIGIYSIPEISFVGRTEGQLTAERVPFEVGVARYRELARGAILGDSYGMLKILVHAE
    SRELLGVHVFGTNATELVHIGQTVMGCGGTVDYLVDAVFNYPTLAESYKVAALDAVNKMRAIAKVTQTGVYRPLPE

    >gi|258650479|ref|YP_003199635.1| Rhodanese domain protein [Nakamurella multipartita DSM 44233]
    MSTPIPEVTVDQVPADAVLLDVREDDEWAAGHAPGAVHVPMTQLADRLDDLPDGNPVYVICRSGGRSARATAYLNQQGWD
    TVNVAGGMGSWARAGRPLEADGDAAPEVI

    >gi|258650504|ref|YP_003199660.1| OsmC family protein [Nakamurella multipartita DSM 44233]
    MTVVYQTTATSTGEGRNGRSRTDDGVLDLALTTPRPGAGPGDPTNPEQLFAAGYAACFHSALKNLAKAAGVDATDSSVSV
    QIGLVKGEDGFHLAAAITGELPRADRAAAADLLEQAHQR
    CPYSKAIRGNVEVTLSVRDA

    >gi|258650585|ref|YP_003199741.1| hypothetical protein Namu_0322 [Nakamurella multipartita DSM 44233]
    MVAMSQAVGKAVISLCTGLEDAEKVTVAFLVAVGAAEQGRTTLMFLTKEAVRLATGSVATGVACAGCPPLADLVARYAAA
    GGSYLV
    CPLCFDAKALSAQTLVANATLGGTVPLWQWIGDDPVVTFSY

    >gi|258650621|ref|YP_003199777.1| thioredoxin [Nakamurella multipartita DSM 44233]
    MATTTLTDSTFERVVQRDGIVLIDFWASWCGPCRMFAPVFEQAATANPDIVFGKVDTEAEPNLASAAGIRSIPTLMVFRD
    GILVFSQPGALPAKSLDQLITAVRGLDMDQVRAQVAAAKAMSA

    >gi|258650622|ref|YP_003199778.1| beta-lactamase domain protein [Nakamurella multipartita DSM 44233]
    MSNVVITGSERARPSGATVTDPGAGTTIVPIETPTLGDRSYLIHDGRVAVVIDPQRDIDRVLRLAGAAGVRISHIFETHI
    HNDYVTGGLALAGVTGAAYHVNAADPVAYERVGVGDGDVVEIGPGWRLRVLATPGHTYTHLSYVLEEHGTATAVFSGGSL
    LFGSTGRPDLLGPDHTHELVHHQYASARRLAAELPEQTQVMPTHGFGSFCSATQTEAVASTIGAEKSTNPVLTQDETHYV
    SDLLAGLDAFPAYYAKMGPANTAGPGAPDLSPPEPADARQLRQRLERGEWLVDLRTRTAFAAGHAPGTLNFGLDGSFATY
    LGWLIPWGTPVTLLGENAAQVAQAQREMVRIGIDRPAAAATGGPRQWTDGPLDTVERATFADLAQVRHHRRVTVLDVRRN
    LERSASRIDGAWHIPLHELLVRADEIPAGELWVH
    CAAGYRASIAASILLARGHRVVAVDDDYSNAAATGLPVTVGA

    >gi|258650624|ref|YP_003199780.1| OsmC family protein [Nakamurella multipartita DSM 44233]
    MTDEVRVRHLGGDRFAVDIREHTVLVDQPVGAGGTDSAPTPTELFVAGLASCVAFYARRYAARHQFSTDGLQVAVGYELG
    GRPARVSRIAIVVTPPAALPPDRRDAFLAVASHCTVHNTLVQPPTIDITLAPDPVAVVGD

    >gi|258650682|ref|YP_003199838.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Nakamurella multipartita DSM 44233]
    MDEFDVVVIGGGAAGLSAALVLSRARRTVLVVDSGAPRNAPASHMHGFLSRDGLPPADLLAAGRREVTGYGGRVVAGTVT
    DVTACGSDRFHLLLADGSRVSARRLLLATGLRDELPDIPGLADRWGRDVLH
    CPYCHGYEVRDQRLAVLGWIPGAVRYAQI
    VRQWSGDVAYVTAGEPLTAADRGQLVARNIEVVDDSVSRLLVDGDRLTGLLTDGGRTVPCDALFVPPRFRPHDALLGRLA
    AHTDQDGWVTTGPTGRTNIPGLWVAGNVTNPRAQVITAAGEGSAAAIDINADLVDDDVRQAVRETNHGLLA

    >gi|258651002|ref|YP_003200158.1| Rhodanese domain protein [Nakamurella multipartita DSM 44233]
    MIRARTAAALTVGVLALTGCSTSATPNGSVASSTGASTGASTGASAVAAGPVRLLDPADFESQSAGRTVINVHIPDEGAL
    PGTDLTLPYNQIKQRAADLPAEKSTPLAIY
    CMSGNMSAIAGRELAQLGYTDIIELDGGMMAWQASGRPLLPAAG

    >gi|258651041|ref|YP_003200197.1| methylated-DNA/protein-cysteinemethyltransferase [Nakamurella multipartita DSM 44233]
    MYAVVDTPVGELTLVGGPGGENVLAAIYFPDHARRPDAAGFGPRDDDAFPTARDQLAEYFAGVRTSFDLELAPRGNEFQR
    KVWQLLTTIPYGQTRTYGQLAAQLGDPGLARAVGAANGRNPLSIVVP
    CHRVVGHDGSLTGYAGGLARKAFLLQLEQPAGD
    RRPTLF

    >gi|258651064|ref|YP_003200220.1| methionine-R-sulfoxide reductase [Nakamurella multipartita DSM 44233]
    MTINPMKSDKTYDVTKSDDQWRAELSPQEYQVLRQAGTERPFSSPYETDETVGVYRCRGCGSELFRSEHKFDAHCGWPAF
    YTPLAADRVELIEDRSMFTTRTEVRCATCGSHLGHVFSGEGYPTPTNDRY
    CINGVSLTLEPVDG

    >gi|258651138|ref|YP_003200294.1| DSBA oxidoreductase [Nakamurella multipartita DSM 44233]
    MTDPVTEVPDEPAAPDGDVPREDGLVDHVRGALDAPVTVIEYGDFECPYCAAAKPVLEEVLAGSAGRVRLIFRNFPLYEV
    HPYALTAALAAEAAAAQGAFWPMHDMLFAHQTRLSDWDLAKYATKLGLDGSRVIGDPAQPYGDKVEADFALALAAGVQGT
    PTVFINGVLYEGRFDVTGLRRAVAQAGG

    >gi|258651161|ref|YP_003200317.1| glutaredoxin 2 [Nakamurella multipartita DSM 44233]
    MTGGHLVTVYTRAGCHLCAEAIATASALATEAGAGFTTVDVDADPEDQAEYGDLVPVIMVDGVLHGYYQVDTERLRAALA
    G

    >gi|258651169|ref|YP_003200325.1| Redoxin domain protein [Nakamurella multipartita DSM 44233]
    MTTRRSLRHALAALGVGVSLLLASCSTGNDAAVYGGSFTFVSPGGQTEFSYPAAERGTVANLSGESLSGEGTVAVSDFAG
    KVVVLNFWGSW
    CGPCRAEAPALEQAATALAPSGVQFLGVNVKDTKSAGADFMASKQVSYPSIYDPSMRTLLAISGYPASG
    IPSTIVLDRQGRVAHIWLRAIDDAQEMIDVIGPIAAEQA

    >gi|258651189|ref|YP_003200345.1| thioredoxin [Nakamurella multipartita DSM 44233]
    MITETELVRSVTDENFADQVLARPEPVLVDFWAQWCPPCHMIAPVLAKIAAERAGTLTVRTIDNDANPVTGARFRVMSLP
    TLILFVAGEPVATFVGAQPKARLLARIDDALR

    >gi|258651533|ref|YP_003200689.1| thioredoxin [Nakamurella multipartita DSM 44233]
    MATIELTKANFESTVSGDGIVLVDFWAGWCGPCQMFAPIFESASQTHSDIVFGKIDTEAEQQLAAAANIRSIPTLMAFRD
    GILVFSQAGALPAPSLEQLIGAVRDLDMDDVRRQIEQSQEAAAAGRSAES

    >gi|258651596|ref|YP_003200752.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Nakamurella multipartita DSM 44233]
    MTRIVIMGGGPGGYEAALVAMQYGADVTLIERDGLGGACVLSDCVPSKTFIASAGGRTAVLAAGSLGLTVDPDQVGVDVA
    VVHGRVAGLALAQSADIRAKLIADGVRIVDGTARLADNASGQATHTVVATAPGGAETDHPADVVLVATGASPRILPDAVP
    DGERILTWRQVYSLDELPEHLIVIGSGVTGAEFASAYTEMGVKVTLVSSRDRVLPSEDADAAAVIERVFSARGSVLARRA
    RAKSVRRTGSGVVVTLEDGREIEGSHALMTVGAVPNTRGIGLEKAGIRLDRGGSIEVDKVSRTSVPGIYAAGDCTGVFML
    ASVAAMQGRIAMWHALGEGVAPLRLKTVCSNVFTHPEIATVGYSEVEAETGPALAQTQMIPLATNARAKMLGLEEGFVKI
    VSRRLTGIVIGGVVCAPEASELILPIAIAVQNRLTVKDLAYTFSVYPSLSGSITELGRRLMHSDTEGI

    >gi|258651927|ref|YP_003201083.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nakamurella multipartita DSM 44233]
    MTSTQFGPPVATGDPAPGFTLPDADGNPVSLSDFAGRPVILYFYPAAMTPGCTTQACDFTSARGSFDGGGYTVLGISPDQ
    PDKLARFREKEDLSIVLLSDADRSVMNAYGAYGEKKQYGKTVQGVIRSTFVIGADGRIEQAWRNVKATGHVARVLKELGL
    AS

    >gi|258651941|ref|YP_003201097.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Nakamurella multipartita DSM 44233]
    MDERYDVVVVGGGAAGLNGALMLGRSRRSVLVVDAGEPRNAPAAAIHGLLGREGMAPADLLARGRAEVAGYGVTLATGSV
    TDISREHEGFVVRCSDARSVAARRLLITTGVVDELPEIDGLRAQWGTGVLH
    CPYCHGWEARDQAIGVLATGPMSIHQALL
    FRQLSDDVVFFTHGSDPTPESRDTLAAVGIGVVDGTVAAVEAADGRVSGVRLGDGTVVARKHLVVASRPVARADFLRGLG
    LELVEHPSGAGQHLPVDGMGRTEAAGVWAAGNVTEPFAQVGADAAAGAFAAAQINADLVFEQTRLAVAAARTEPAHH

    >gi|258651965|ref|YP_003201121.1| heavy metal translocating P-type ATPase [Nakamurella multipartita DSM 44233]
    MTQQAVDLQIGGMTCASCAARIEKKLNRMPGVQASVNYATEKAHVVLPEGTEVAAAIATVEATGYTATLPRPILEPARPP
    DTDPAAGGAGEPALDPEVASLRRRLVISAALTLPVLVLAMVAPLQFDNWQWLSLTLAAPVVVWGAWPFHRAAWTNLRHGA
    ATMDTLISLGVLAAFGWSLYALFFGGAGMPDMRMTFRLLPEPGAGADEIYLEVAAAVTVFILAGRYFEARAKKRSGAALR
    ALMDMGAKDVSVLREGREQRVPVDQLVVGDRFVVRPGEKIATDGQVIEGASAVDASLLTGEPVPIEVGPGDAVTGATVNA
    GGRLVVRATRIGTDTQLAQMARLVEAAQSGKAPVQRLADRVSAVFVPVVIALAVGTLGFWLGAGAGAEAAFTAAVAVLII
    ACPCALGLATPTALLVGTGRGAQLGILIKGPEVLESTRRVDTIVLDKTGTITTGRMTLVEVIPGAGTDEAELLRLAGALE
    HASEHPVAAAIVDGARDRVGDLPAVESFVSTQGLGVHAVVDGHAVAAGRASWLAQEWAQPLDAELDRARRDAESAGRTVI
    AVGWDGAARGLLVVADTVKPTSAQAIAELRGLGLRPVLLTGDNAAAARAVAAEVGIDPADVIAEVLPADKVRTVADFQHR
    HAIVAMVGDGVNDAAALAQADLGLAMGTGTDVAIEASDLTLVRGDLRAAVDAIRLSRRTLGTIKGNLFWAFAYNVAALPL
    AMAGLLNPLIAGAAMAFSSVFVVSNSLRLRRFKAVSGRTA

    >gi|258652052|ref|YP_003201208.1| hypothetical protein Namu_1829 [Nakamurella multipartita DSM 44233]
    MSQATVNAPVSDSSTDPTAEASTDRVDFWFDPACPFAWVTSRWILEAEQVRPIDVHFHVMSLAVLNENRAISENYRAMLA
    KAWGPVRVAIAAQQQHGDEVLAPLYTAMGRRIHNEKIDDRGEVIAQALAELGLPAELADAATSTEYDDALRVSHHAGMDA
    VGEDVGTPTIHVNGVAFFGPVITRIPRGEEAGKLWDATVALASFPYFFELKRSRTENPQFD

    >gi|258652087|ref|YP_003201243.1| dihydrolipoamide dehydrogenase [Nakamurella multipartita DSM 44233]
    MTDTNVDLVVLGGGSGGYAAALRAAELGMSVALIEKEKLGGTCLHWGCVPAKTLLHAAEVADEAREGASIGVKSTFDGID
    VPALLKYKDGIINRLYKGLQGLVKSRKIQLVEGEGKFVGPNTVVVGGDRYIGKDVILATGSFSRTLPGLTIEGRVITSTQ
    ALSLEWVPETAIVLGGGVIGVEFASTWASFGTNVTIVEALPTLVPLEDPWAAKLVERAFRKRKINFKTGVRFKSVTQDDS
    GVTVLLEDGTELKADLLLVAVGRGPYTAGCGYEEAGITMDRGFVITDERLHTNLPHVYAVGDIVPGLQLAHRGFQQGIFV
    AEEIAGLNPVVIPDEKIPKITYCDPNVASVGATEAVAQERYGKDNVESYVYDLGGNGKSQILKTAGGIKVVRVKDGPVVG
    VHMVGARIGELIGEAQLVVGWEAHPEDVAPMVHGHPSQYEAFGEAMLAMAGKPLHVHD

    >gi|258652269|ref|YP_003201425.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Nakamurella multipartita DSM 44233]
    MAGEGLSVGAVAPDFTLPDANKAPVALSSFRGRQPVLLVFYPFAFSSVCTGELCQLRDELAAFVDAGVQVLAISTDTSQS
    LKAWGTEQGFQFPLLSDFWPHGEVAKAYDVFFDKAGMALRGTFLVDVDGVIRFAEVNGPGQARDQVAWQRAVTALVLSRS


    >gi|258652350|ref|YP_003201506.1| UBA/THIF-type NAD/FAD binding protein [Nakamurella multipartita DSM 44233]
    MTLPPLVEPAESLTKAEVERYSRHLIIPDVGMIGQKRLKNAKVLVVGAGGLGSPALLYLAAAGVGTLGILDFDTVDESNL
    QRQVIHGQSDIGKSKALSAAESIAEVNPYVTVNLHTERLDSGNALEIFAPYDLILDGTDNFATRYLVNDACVLLGKPYVW
    GSIFRFEGQVSVFWAEYGPQYRDLYPEPPPPGMVPS
    CAEGGVLGVLCASIGSVMVTEAIKLITGIGEPLLGRLMVYDALE
    MTYRTVRIRRDPAGEPITGLIDYDAFCGTLSDEAAEAAISHTISARDLKAKMDAGDDFVLIDVREQNEYEIVSIPGSVLI
    PKGDIISGEALSSLPMDRPLVLH
    CKSGARSAEALAVLHKAGFGDAVHVGGGVLAWIKQVDPSLPTY

    >gi|258652405|ref|YP_003201561.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Nakamurella multipartita DSM 44233]
    MHFDLVVVGSGSGNTILGREFRDQRVALVESGAFGGTCLNAGCIPTKSFVYPADLADAVTRADRLGLKATVAPVDWAVLR
    DRIFSRTDEISAHGLEYRQGDKWPNLEMLTGIARFTGVKSMAVDLTAGGRVDLTADRFVLAAGGRPVIPDIPGLDEEIVG
    EGVVHTSDTIMRIAQRPDRIVIIGGGYIAAEFAHVFDAFGSRVTQVVRGSRLLRHHDEDVATTFTDHVRARYDLRRDTEI
    CGIKPLDGQGVRVFLEGPYGEATVDADVLLLATGRRPNSDLLNLPATGVTVNEQSRVVVDEYQETVVPGIYALGDLSSPY
    ALKHVANHEARVVRHNLNHPDDRITTDHRFVPAAVFTEPQIAAVGLTEQQAREQGVEYVVGRRDYGGTAAGWAREDTTGF
    AKVLADPRTGLLLGAHVIGPEAATVIQPLVQAMSFGQRAHDVARGQYWIHPALPEVIENALLALPRPTG

    >gi|258652640|ref|YP_003201796.1| protein of unknown function UPF0061 [Nakamurella multipartita DSM 44233]
    MGQVTVAPTSSVALDGRFARELPELAIAWPAQPVDDPTLLVLNEPLAGRLGLDPDWLRTPDGLRLLTGTVLPDGATPVAQ
    AYAGHQFGGFSPRLGDGRALLLGELVDVDGRLRDLHLKGSGRTPFARGGDGLAAVGPMLREYVISESLHALGIPATRSLA
    VVATGRPVYRESTLPGAVLARVASSHLRVGTFQFARGTGDGQLLRRLADHAIARHYPQAAVAEQPYLALFDAVVAAQAEL
    IARWMLVGFVHGVMNTDNMTISGESIDFGPCAFLDAFDPATVFSSIDTGGRYAYRNQPVVAQWNLARLAEAMLPLFADDQ
    EAAVDLATQALGRFGDRYQATWTRGMRAKVGLPDGLDDGVDDHVAAALIDELLDQLQGSRVDYTGFFRALGVAARGDTEP
    ARSLVLDIAAFDEWAQRWRAVAPDGELMDRTNPVYIPRNHLIEQALEAATGGDLDPVGELLAAVSAPYQPRPGLERYAEP
    APDDFGAYRTF
    CGT

    >gi|258652744|ref|YP_003201900.1| redox-active disulfide protein 2 [Nakamurella multipartita DSM 44233]
    MIIKVLGPGCTNCVNLERVTRQAVDALGVDATIEKVTDYPTIVGYGVMATPALVVDEKLVLSGRVPTAAQVRELLTPLAV


    >gi|258652747|ref|YP_003201903.1| OsmC family protein [Nakamurella multipartita DSM 44233]
    MREELAVRHLDGDRFAVDVRGHTLLVDQPAEAGGTDTAPTPTELFVAGLASCVAFYARRYLARHQIDAAGLTVSASYEIG
    GRPTRVLRIIIVVTPPADLPAERRDAFLAVASHCTVHNTLTEPADIEIALAATAAALN

    >gi|258652759|ref|YP_003201915.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Nakamurella multipartita DSM 44233]
    MKIVVVGGVAAGMSCAARARRLDESAEIVVFERANHVSFANCGLPYHIGEVIKDRSRLLLQTPQSLHESLAIDVRIATEV
    LAIRPDRKSVTVRDLDSGREYEEPYEQLALCPGASPITPPLPGVDHPDIHVLRRIGDMDVIKAAVDGRSASGRPPITHGV
    VIGAGYIGLEMAENLHERGVQVVVVEMADQIMPPLDRELTTTMESYIRAHGVELRLGTQAAAFSRSPGGWLRVELTNGEF
    VQTDLVLLAAGVRPSTELAVAAGIDLGPRGGIKVDAHMRTSVPGIYAAGDAIEVEHLVLPGTWLIPLAGPANRQGRVAAE
    NMCGRDTVFDPVQGTSIVKVFDMVAGGTGANQRQLDAAGVPYERVQIHPSGHAGYYPGTAKMQLKVLFEPVTGKLLGAGI
    VGFDGVDKRLDVLATALRGGMTVHDLEGLELAYAPPFGSAKDPINMAGFVAANLLKKDLRLWYPSEYPGATDGARIIDVR
    GPQEYAIWHLPGAENVPLPTLREAQQDWDRSRPIRLY
    CAVGFRSYLAYRALVQRGFTDVRTLSGGMTTFRSYHDVPSAES
    VDTIEPVVNYGEDRTGINAVRVTAAGPVAATGVLVDLDCTGLACPGPIMALQARMAELAPGDEVLAHVSDPGFRLDAPAW
    AAKNGHSMLELVPEGPGYAARFRKGGIGIVPGGPAARLKDKKSFVVFSGEFDRVLASFILANAAASMGDEVSMFFTFWGL
    NALRRLDPPTREKNALDRAFSAVLPSGPDSLPLSTMNMFGGGPALIKKIMKDHHVPSLPELIASAQQTGVRLIACTMTMD
    LLGIAHEDLIDGVELGGAAMFFGEANESNGAFFI

    >gi|258652763|ref|YP_003201919.1| thioredoxin [Nakamurella multipartita DSM 44233]
    MATTTLTDRTFEGVVSGGGIVLVDFWASWCGPCRMFAPVFEKAATAHPDIVFGKVDTETERNLAAAAGIRSIPTLMAFRD
    GILVFSQPGALPAKSLDHLIAAVRDLDMDQVRAQVAAAKAKSA

    >gi|258652764|ref|YP_003201920.1| Rhodanese domain protein [Nakamurella multipartita DSM 44233]
    MLEMREVSMTEVEKARTAGAVVIDVGDVEEYDRGHIPGAASLPLGDLSRDLSVASCQIRRDAPVFVVCAAGNRSLIAAGM
    LMHAGYDAFSVRGGTRAWVKAGNAVVGGDHVRY

    >gi|258652765|ref|YP_003201921.1| beta-lactamase domain protein [Nakamurella multipartita DSM 44233]
    MSVTDVPRVGITDQDGGTGVTVVPIETPTLGDRSYLVHDGRVAVVIDPQRDIDRVLDAAAAAAGVRITHIFETHIHNDYV
    TGGLALARATGAAYHVNAADPVTYERVAVRDGDVIGIGSAWRLRVLATPGHTYTHLSYVLEDHGTATAVFSGGSLLFGST
    GRPDLLGPDHTHDLVHHQYASAQRLATELPEQAQVLPTHGFGSFCSSTQTEATASTIGAEKASNPVLTLDEDRYVSELLA
    GLDAFPAYYAKMGPANTAGPAAPDLSPPELADARQLRRRLERGEWLVDLRTRTAFAAGHAPGTLNFGLDGSFATYLGWLI
    PWGTPVTLLGETADQVAQAQREMVRIGIDRPAAAATGGPRRWTDGPLGTVERATFADLAQVRHHRRVTVLDVRRNLERSE
    SHIDGALHIPLHDLLRRVDEIPAGELWVH
    CAAGYRASIAASILLARGHQVVAVDDDYTNAAGAGLPVIVGT

    >gi|258652970|ref|YP_003202126.1| OsmC family protein [Nakamurella multipartita DSM 44233]
    MAALSYTTTATAWGGRMGRVATSDGTLDYQLSMPESMGGEGGEGTNPEQLFAAGYAACFHNALRSVARKEKVDVTDSAVS
    VTVQIGGTATDGFRLAITIEAEMPGVDRETGQRVLDGAHGR
    CPYSRALAGNHDLTLVLVDPS

    >gi|258653016|ref|YP_003202172.1| Methyltransferase type 11 [Nakamurella multipartita DSM 44233]
    MTDWDGAGYERISGLQRRLARATLGQLSLAGDERVLDVGCGDGYITRAIAARLPGGSVLGLDASPRMIAAARSHADPPGA
    RVAFEVGDVLGLTAVDEFDVVVSFNALHWVADQVAALTAIGRATRPAGRVVVQQVCAGPRRSLEATAMAV
    CHTQAWSAFF
    SGFGAPFVHVDPRRYADLAAAAGLRVTDQQVEDIRWDFGSRAAFTDWCTVGFADWTGRLPPDRVADWVQAVVEAYQQQVG
    EPGVFRFLQLRAELVPSTIRGSGT

    >gi|258653031|ref|YP_003202187.1| OsmC family protein [Nakamurella multipartita DSM 44233]
    MDKQSLVARQAPFKQQYRDDPTSAMITLRADAQLGEGVSCSVSTGRALAEAGLHPAAGGDGTQLCSGDMLLEALVACAGV
    TMKAVAISLGIELRGGTVRAEGDLDFRGTLAVAKDAPVGFTTIRLGFEVDSDADEEQLAALLKLTERYCVVWQTLRQPPA
    GSVTLTTTG

    >gi|258653422|ref|YP_003202578.1| iron-sulfur cluster assembly accessory protein [Nakamurella multipartita DSM 44233]
    MTVADTTAATGVAKAHGVTLSDAAAAKAKELLDRDGTAEMVLRIAVQPGGCSGLRYELFFDDRALDGDALVEFGGIGLAV
    DRMSKPYLDGAVIDFVDTIEKQGFTIDNPNAQNSCACGDSFH

    >gi|258653616|ref|YP_003202772.1| peptide methionine sulfoxide reductase [Nakamurella multipartita DSM 44233]
    MASAQTATQTAILAGGCFWGMQDLIRRQPGVISTRVGYSGGEVPNATYYNHGSHAEAVEIVFDPSVTSFRNLLEFFFQIH
    DPTTRNRQGNDIGMSYRSAIFYLDDEQQRVAQDTIADVEASGLWPGKVVTEVSPAGPFWEAEPEHQDYLLRYPNGYTCHF
    PRPGWKLPRRATV

    >gi|258653737|ref|YP_003202893.1| thioredoxin [Nakamurella multipartita DSM 44233]
    MTAAAQKSTKVACGNCGATNRVPAVANGIPRCGKCSTPLRWVVDATDDEFHAVVDESSLPVLVDVWAPWCGPCRMVSPAL
    EKLAGELAGRLKLVKVNADANPEVSRQFEVRSIPTLVILDHGQVIDKQIGARPEPQLRSWLESKLPRKA

    >gi|258653920|ref|YP_003203076.1| Rhodanese domain protein [Nakamurella multipartita DSM 44233]
    MKPSPAPPLIRADELAHELAGPRPDRIAPILLDVRWSLAGSDEPGFVAGHLPGARFLDLDRHLAGAAGPGGRHPLPPAES
    LQAALRALGLTDQSPVVVYDGGSGLSAARAWWVLRWSGLARVRVLDGGLPAWLADPARPTESGLAAPPAAGSVTVRPGAM
    PTVTVQEVDRAIGSGIDAQGAADHPVLLDVRAAARYRGEVEPLDPVAGHIPGAVNLPIGELMRPDGTYRPAAEIATVLQA
    VGLTDGTPAIAS
    CGSGVTACQLVLAAELVGRRAALYPGSYSQWCALGRPVATGAGRPGAEV

    >gi|258654145|ref|YP_003203301.1| OsmC family protein [Nakamurella multipartita DSM 44233]
    MPSRVATTQWSGGLQDGSGQVTLTSSGTGTFDVSFPRRAADDAEGVTSPEELIAASHSSCYSMALSNELTTAGGTVKSLV
    TQADVTLGPDPAGGFRLTGIKITVRGQVDGLDNDAFLKAAEAAKAG
    CPISKALTGTTITLDAALA

    >gi|258654230|ref|YP_003203386.1| dihydrolipoamide dehydrogenase [Nakamurella multipartita DSM 44233]
    MADHDIVVLGGGPGGYAAALYAASAGLSVALVEKEKVGGTCLHRGCIPAKALLHAAEVFRTVEHAAAHGVKLPDGFKAEP
    DWPAANTRKAGIVKQLHGGLSGLLKRRKVQVVIGEGRLLADGSVSVDGQTLKGKATILCTGSVPRAIPGMDIDGERIITS
    DHATNSTADKLPERAVVIGGGVIGAEFASVYTDLGVDTTLLEAMNDGVLPIGPDRDVANVLAKSLTKRGTKINAQARVGT
    LERTSNGVLVPFETPKGSEKLEVEQVLVSIGRRPVTETVGAAEAGVRITDRGFFEVNPTTMLTSKPGVYAIGDCVPTPGL
    AHVAYAEAVLAVDHFLGENPVPVDYAKIPWVVYTHPEVAWSGLTEAQAREAGHDVVVHKHSFAGNGRAMILGETDGLVKI
    VAAKDGPVLGMHLVGPWASELMHEGYLAVNWEALPSEVGRLIHAHPSLSEAIGETMITFSGRSLHG

    >gi|258654555|ref|YP_003203711.1| methylated-DNA/protein-cysteinemethyltransferase [Nakamurella multipartita DSM 44233]
    MITALEAALGHGHPDTQALRRLHDRLAAAARADGLLDVSYRTLDTPVGCLLLAATPVGLVRIAFAGQDHDRVLEDLAGRV
    GPRILADARALDPVVRELDEYFAGTRTRFDLPLDQRLSTGFRAAVLAQLPHIDYGRTASYAQVAQAAGHPRAVRAVGTAC
    GANPLPIVVP
    CHRVVRADGTPGGYAGGPQAKRVLLALEGAA

    >gi|258655047|ref|YP_003204203.1| Rhodanese domain protein [Nakamurella multipartita DSM 44233]
    MSAIEDLLARARDRLDRVSPEGLAAEAAAGALVVDTRPVEQRERDGPLPGAIVVDRNVLEWRLDPTSAHRLPVATDHDRR
    IIVV
    CNEGYSSSLAAATLRDLGLHRATDLVGGYHAWRQHRAEQP

    >gi|258655092|ref|YP_003204248.1| Rhodanese domain protein [Nakamurella multipartita DSM 44233]
    MSREDSLVTTDWAEQNLSTPGIVFVEVDEDTTAYDAGHIPGAVRINWKTELQDPARRDFVDRAGFEKLLSAKGISNDDTV
    VLYGGNNNWFAAYAYWYFKLYGHQDVKLIDGGRKKWELDGRVLSREVPDRVETTYTAQDQDFSIRALRDEVVAAIGTQNL
    VDVRSPDEFSGKLFAPAHLPQEAAQRAGHIPTALNVPWSKAANEDGTFKSDAELAELYGNLDDEKDTIAY
    CRIGERSSHT
    WFVLTEILGKKNVKNYDGSWTEYGSLVGVPVELGA

    >gi|258655378|ref|YP_003204534.1| selenide, water dikinase [Nakamurella multipartita DSM 44233]
    MGTTASIDRAEGIRLTGYAHGGGCACKIPPGELEDAVRGLVGQAGPDVLVGLDSGDDAAVVRLRADLAVISTADFFTPVV
    DDAYDWGRIAAANALSDVYAMGGRPVVAINLVGWPRGVLPMELMTEVLRGGLEVGAAAGCPVIGGHTIDDPEPKYGMAVT
    GVAHPDRLLRNDSAEAGRPITLTKPLGLGLLNNRHKRTGEVFPEAIATMTQLNRDAADAALAAGAKAATDVTGFGLLGHL
    HKMVRASGVGAVIDRGAVPVLEAARQALRDGFVPGGSARNLDWVRPHLRAGAGVTEDDLLILADAQTSGGLLVIGEVPGY
    PVIGHTVAGAGIDVR

    >gi|258655405|ref|YP_003204561.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Nakamurella multipartita DSM 44233]
    MDSYDMIVIGSGPAGQKAAIAAAKLGRRAAIVERKDMVGGVCINTGTIPSKTLREAVLYLTGLNQRELYGQSYRVKQDIT
    IADLSSRTQHVIAREIDVIRNQLARNHVHMYVGTARFITPRTIVVTNEAGNSVELSADKIVIAVGTKPAHPSTVEFDGET
    IVDSDQILSIAKVPSSMVVVGAGVVGIEYASMFAALGTKVTIVERRPTMLDFCDKEIIEALQYQLRELAVTFRYSETVRE
    VQRHPAGTLTVLESGKRIPADTVLYSAGRQGLTDELNIAAAGLGASDRGKIEVNENLQTEVEHIYAVGDVIGFPALAATA
    MEQGRRAAYHAFNEPVGNKLGDLQPIGIYTIPELSFVGRTEESLTSANVPFEVGVSRYRELARGAILGDSYGMLKILVHA
    ESRELLGVHVFGTNATELVHIGQMVMGCGGTVDYLVDTVFNYPTLAESYKVAALDAVNKMRAIAKVTQTGPYHPLPE

    >gi|258655497|ref|YP_003204653.1| thioredoxin reductase [Nakamurella multipartita DSM 44233]
    MNQFVSIPAPSGDPVAASADEHIHDVIVVGSGPAGYTAAIYLARAELAPLVFEGYTYGGALMNTTEVENFPGFPAGIIGP
    ELMAQIREQAERFGADLRTVDVEQVDLTGPVKSVTVDGVVHRARAIVLATGSAARYIGLPDEQRLLGRGVSA
    CATCDGFF
    FRDQDILVVGGGDSAMEEATFLTRFARSVTIVHRREEFRASAIMLDRARQDPKISWRTNAAVTALHGETSLTGVTLTDTR
    TGEQTELAATGMFVAIGHDPRSELFRDQVSTDPEGYVLTGHHVSAIASTGTSIEGVFACGDLVDHTYRQAITAAGSGCAA
    ALDAQHYLASHPAPAGDLDAHRTTDPMPDEPRAAFEDALSV

    >gi|258655498|ref|YP_003204654.1| thioredoxin [Nakamurella multipartita DSM 44233]
    MATVKVTDDSFTTDVLQSDKPVIVDFWAEWCGPCRMVAPILEEIATKHEGKVTVAKLDIDANPQIAQQYQILSIPTMLVF
    QGGKPVKQVVGAKPKAALLAEFADILA

    >gi|258651964|ref|YP_003201120.1| Heavy metal transport/detoxification protein [Nakamurella multipartita DSM 44233]
    MSTTTATYAVSGMTCSHCVTAVTEEVSQLDGVSAVEVDLHAGGDSRVTVTSRAPLPLDAVRAAIDEAGYSLAS