Myxococcus xanthus DK 1622 uid58003

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|108757850|ref|YP_628461.1| rhodanese-like domain-containing protein [Myxococcus xanthus DK 1622]
    MHPLCDNAAPHPAGYRDVEVGQLAAFLPSELTLVDVREAAELDGILGHVAGIRHVPLATVPDVVDAWPRDTDVVMICRSG
    ARSARAATSLVALGFTRVMNLRGGMLAWNTARLPVVRPIPHTLPTLGTVRDGLLDGLHRAVAPPPHEGPTVPPLTTPSRE
    ALTAVLDALQAARPTDVRDTAAFEHLLRTYRDLLAVARAEGER

    >gi|108763154|ref|YP_628481.1| rhodanese domain-containing protein [Myxococcus xanthus DK 1622]
    MTPQELSEKARQLVAEGAVLLDVRTPQEFQEGHPEPARNIPVQELPRRLAEVGPPGTPVVVYCAAGGRSAQAVQLLRANG
    FPDVFDLKSVKNW

    >gi|108763795|ref|YP_628559.1| mercuric reductase, truncated [Myxococcus xanthus DK 1622]
    MAEAFDVVVIGAGPAGEVAGARAAEAGLSVALVEHELLGGECSYWACIPSKALLRPSEARWLAEHAAGVREKLQEGIDAR
    AVLAHRDSMVNNYQDDSQVKWAENAKLKVVRGTGKLTGPRKVRVEDKDGAVRELEARKAVVLATGSHPRIPDIPGLKDAQ
    PWDNRQGTAARQVPKRLVVLGGGAVGVELAQAWRSLGSEVTLVQRGKRLLSRAEPFAGEQVAQALRDAGARVLLGMNATR
    VQRPGGKGEVTVTLSNGEQVVADEILVAMGRVPRTEGIGLETVGLVGGKPVEVDDQLRAKGVDGGWLYACGDTNGRNLLT
    HMGKYQARMVGDVIAGKQARAWADAKATPQVVFTHPQVASVGLTEAKAREAGLPVRTVEQQLQDVSGTSLVGKGLTGTVK
    WVVDEKRRVLVGATFTGPEVGEMLHAATIAVAGEVPLDTLWHAVPSFPTMSEVWLKLLEAYGL

    >gi|108761980|ref|YP_628569.1| hypothetical protein MXAN_0289 [Myxococcus xanthus DK 1622]
    MTHQQSKRLGVVGGIGLLLVAAVAWADLPASAVASSAPDEGDPRIEGALLVDATEVKPGDTFRVGVRFRLDPGWHVYWKN
    PGDSGLETEVAWDTPGVTVGPLQWPFPQTFRTPDGFITTHGYDGEAILIADAKAVEGPSTGLLTVSAAVEALVCEVHCIP
    AELMLTRSIPLGPQTVRDAETAAVFDTELAKVPRPAKDSGPAATVALDAPQLTAGQDFTGTLTLTAPGGAAVPAVEGDFF
    VADRIPGVVRVGLASDGPGRFKLKGKAEPDAQASAPDLTGVLRLGTAATGYQYLEVTAPLAPLVAAGGAAGTPAVVKPPS
    VKDSIAAVKPVGAAIATPPAAESSMGLGLALVFAFFGGALLNLMPCVFPVLALKAYGFTRMVQQEQGRVGAHAAAYAAGI
    IGTMLLLASVVLAVRAGGASVGWGFQFQEPLFVAGVCAVLVAFALNLFGVFNVGLDGTALAGKVDQSHGLMHSAGEGVLA
    VVLATPCSAPLLGTAVGFAFAAGPMTVLAVFTALGLGLALPFCVLVLVPGLAKKLPKPGAWMERFKQVLGFALLATTVWL
    VWVMGGLAGVDGMARLLAFLVAVGLVTWLYGQGQAQDGVRKLATVAVAAGVLVASGLLTLRFDDQDPVEAPRVGSTVAQA
    QPWSADAVNAALAAGQPVFIDFTADW
    CLTCKFNERTVLSTDEVRDAFKKHQVAFFIADWTRRDASITTKLAEHGRAGVPM
    YLVLSPGAPDKPEVLPELLTPGVVTDAVTRAAACAPSKLGNGANVLCAAGFPSH

    >gi|108760975|ref|YP_628570.1| hypothetical protein MXAN_0290 [Myxococcus xanthus DK 1622]
    MKQVFTALALGTLLIGAPALADAEVGKPAPTFTLKDESGKEHTLAQYKGKVVVLEWTNPECPFVQRHYKNDTMVTTLKGF
    DAKKVVWLAVDSTAHNTPEKSAAWKKDEGFPYPVLQDASGTVGKSYGAKTTPHMYVIDETGVVRYAGAIDDDPRGKNAKP
    ANHVKTAVDAVVGGQQVPASTTTPYGCSVKYKS

    >gi|108757362|ref|YP_628625.1| thioredoxin domain-containing protein [Myxococcus xanthus DK 1622]
    MKTLHKPLQITLYQDVLCSWCYLADLRLDVLRQELGEAVRWSVRPYPLRVHDVLPTTREQRALVEEVERAQREPDAAARM
    LSTDLWLGGDPPRTSVPALAALEAARLQGPQARAFLARAMQRAALEQGVNVSRPDVVFELASRVGLAMNEFSAAFRSEET
    RRLILDEHRDATHRGVRGVPTLVIGGRWMLCGLRELAEYREHILACLGKVSVPRSGSPERVVH

    >gi|108760020|ref|YP_628714.1| pyridine nucleotide-disulphide oxidoreductase domain-containing protein [Myxococcus xanthus DK 1622]
    MTNRAAWTRREALALAGLGLAGAALPLGCRHAMDATRTDDMERKDVKDVVVVGGGPGGLSAALALGRGRKKVLVCDGGTP
    RNAAAEEVHTYLTRDGIPPREFRRVAWEQMRPYDVELREARVLDVERAGTVFRVALEGGDVVEARRVLLATGMVDVMREL
    PGYSDLWGKAIFQ
    CPFCHGWEIQDRAWGVLATNAVSLDFAVMLTGWTRDLVVFAMDGFEVPSDKRALLEKAGVRLETRRI
    RGLIAAGEKLDAVELEDGTRVPREILFDRPPQRQSSLVQRLGLELNEEGFVKLKGPGETSVPGIYAAGDLGTRAQAAIVA
    ASAGMLAAGMLNHDLNLERAGAAHGPAQG

    >gi|108760069|ref|YP_628923.1| organic hydroperoxide resistance protein [Myxococcus xanthus DK 1622]
    MAPVAISPLYSTSATAHGGRNGRVKSEDGVLDLPLAMPKELGGAGGAVTNPEQLFAAGYSACFESALRLVARMQGKNLGN
    DAGVRATVTIGKTPDGGFGLAVELQGILPGIPNDEAQKLMAAAHEV
    CPYSKATRGNIDVKVSVAG

    >gi|108762089|ref|YP_629124.1| hypothetical protein MXAN_0863 [Myxococcus xanthus DK 1622]
    MATLEQLRFDNTYARLPAGFGARVHPSPFPDAKLVSVNPAALKLLDLTPEEAQRPEFVAAMGGAKPLPGMEPFAMVYAGH
    QFGVYVPRLGDGRALLLGEVRDAAGAKWDLHLKGGGPTPFSRGGDGRAVLRSTIREYLCGEAMHGLGIPTTRGLGILGSQ
    APVYREAVETGAMLVRMAPSHVRFGTFEFFHYTEQTEHVATLADHVITEHFPQLAGQEGRYARFYTEVVERTARLIAQWQ
    AVGFAHGVMNTDNMSILGLTLDYGPFGFLDDFEPGFICNHSDDRGRYAFDQQPRIGLWNLACLGEALLTLISEDEARAAL
    ATYQPAYNAHFMDRMRAKLGLRETRDEDRELVSDLFARMAEAHVDYTRFFRALGHFASADGADTRPVRDMFPAPEGFDAW
    AGRYRARLAAEGSVDAERHARMTRVNPKYVLRNWVAQEAISRAEAGDFSLVDRLLGVLSDPFAEHPDAEPYAAAPPTWGR
    HLAVS
    CSS

    >gi|108762609|ref|YP_629816.1| alkyl hydroperoxide reductase C [Myxococcus xanthus DK 1622]
    MLTVGDKIPNFKVKATVSLEKGKEFQDITNETFKGKWLVLFAWPKDFTFICPTEIAEFGKKNKDFTDRDAQVLGLSTDSE
    FVHHAWRTHHPDLKNLPFPMLADIKHELCNALGILHKEEGVALRATFIADPEGIIRHVTVNDLSVGRNVSETIRTLDALQ
    TDELCPCNWTKGEETLTQKLSKAG

    >gi|108761426|ref|YP_629981.1| thioredoxin family protein, selenocysteine-containing [Myxococcus xanthus DK 1622]
    MHKEPMRRPLCAPLLLALALLLGACDRQDRYDRPGTPVPESLWAETLEGERIDRAALLGRPWVINVWAPGCHACARELPE
    LEALRSEYEARGVGFLALSLNPSEARNRETAAALGVHMTVATAKGEVLGPLRISTVPATVFINREGVVVAAVNGERSRGF
    YARRLEALLAAP

    >gi|108758314|ref|YP_630157.1| thioredoxin family protein [Myxococcus xanthus DK 1622]
    MKRYPGGEPYDLASDRGSVVVLDVWATWCEPCKDALPYYQDLANEYAAQGLKVYALNIDEDPRAIPAFLAETKVTLPILL
    DQNAQVAERTLKVRGMPTTYFIDRKGMVRHVHEGFAEEFLAKYQTELEALLAEPTP

    >gi|108760871|ref|YP_630192.1| thioredoxin-disulfide reductase [Myxococcus xanthus DK 1622]
    MAEEKINKVTIIGSGPAGYTAAIYAARANLQPVVFAGGPTLEHPQRVPGGQLMVTTDVENYPGFPEAITGPELMDRFQKQ
    AERFGTTIHMENVVKVDFSQRPFLIQGESVSCRSETVIISTGATAKWLGVKGEDTYKNRGVSA
    CATCDGAFFKKQDVLVV
    GGGDTAMEEATYLAKIVNHVTLIHRRDTLRASKVMQERARQNPKISFMWDSAVEEVLGDAKGMNGAVVRNLKTGDSQQVK
    ATGLFVAIGHTPNTELFQGVLETHQGGYLKTVPGSTRTNIEGVFACGDVQDHYYRQAITAAGTGCMAAIDAERWLIEHGE


    >gi|108758025|ref|YP_630237.1| selenide, water dikinase [Myxococcus xanthus DK 1622]
    MAEKKTDKVKRLTELSHCAGCAAKLRASDLAQVLGGLKSTKGPQALVGFSTNDDAAVYRLAPGMAVVETVDFFPPVVDDP
    FQFGAIAAANALSDIYAMGARPLFALNLVCFPDELPLKVLSKILAGGQSKADEAGIPILGGHSIRDPEPKFGMAVTGVVH
    PKKVLTNAGAKPGDVLFLTKPLGSGIATTAIKRGVASKQLAKRALGVMTTLNRAAGEVFASGKFKVNALTDVTGYGLLGH
    LLEMMTAAKARATLDLERIPLIAEVPALAEDGVVPGGTKSNLAHVHKKVRFPEGLPECIQWVLADAQTNGGLLASVPARQ
    ALKALKALEAAGVDAALIGEVQAGKPGIDVVG

    >gi|108760369|ref|YP_630253.1| glutaredoxin-like protein [Myxococcus xanthus DK 1622]
    MTPELKARLEQETRSHKIVLFMKGNALFPQCGFSARALQLLQPLGQVHTVDVLADPEIRQGIKDFTNWPTIPQIFINGQF
    VGGSDILMELAERGELADLVAGKSPA

    >gi|108763111|ref|YP_630317.1| thiol-disulfide oxidoreductase resA [Myxococcus xanthus DK 1622]
    MGGGTKLVLGLLGALGVGGVVFLGVLEAQRARLVPDGTTAPTMEMARHGGGTMKLEDLKGQVVMLDFWATWCPPCREEMP
    ALVKLAKEYEPQGLVFVAASRDDGDRAPKLVEAFMRNHLPELAPYVVYADDNVARAFQVSALPTLYFLDRDGKVIDAQRG
    ALSEDGIRRRIERALKQP

    >gi|108761722|ref|YP_630408.1| hypothetical protein MXAN_2185 [Myxococcus xanthus DK 1622]
    MKPRMNAFAVAPDAMKLTLDYGQKLLELGLEKSLQELVKIRASQLNGCAFCIHMHSRDARAHGETEERIYLLDGWRESPL
    YTERERAALAWTEALTHVSQTHASDEDYAALAPHFSEQEIVHLTLLIGMINTWNRISVGFRSIHPVTTPRTEAA

    >gi|108762383|ref|YP_630410.1| hypothetical protein MXAN_2187 [Myxococcus xanthus DK 1622]
    MRLAVGALLLLWGCATPPAIPQRPLPAKAGPVFLENDWEGALRAGREGRRPVLVEAWAPWCQSCRSMRATVLTSPALDAW
    ADRFVWLAVDTDADTSMAFLQRYPVDTWPTFFVLEPEHGAVLARSLGAVSLPQFLGLLEQSERTFQQGRLGTEALVRADA
    LALSGQHGEAAVAYQRALEQLAPEDARRAGALVSWSKSLAATGASADCMRVAASELPKLSRVDDRTRLLYVGMGCALDTN
    TDEARAVRGQFADEANRALGAPETELTPLQRSSLYELACEAREASGDEAGLRDQARTWWAFLQLQATHANGAEERAALDS
    HRVMATALLDQPDAAIPLLERSERELPGDYNPPARLATLYLMAGRKDEALTASKRALALAKGVSRGTVLAGHARILMAHG
    ERAHAERLLTEALSEMDRTPGIPQDHLQRKVLERTLARLRASNGASPK

    >gi|108757067|ref|YP_630477.1| putative thioredoxin [Myxococcus xanthus DK 1622]
    MAGQTVELTQENFERITQEAGVCVVDFWAEWCGPCRGFAPTFEAAAKEFPNITFGKLDTEAQEEVSGRMEIRSIPTLVAF
    KDGVEVRRASGAMSASAFATWLSKLDSVDLAVEQQRAANRKLTEEGTPPPGIPPHAEWDAGDEEWCSGDTDEEGEKHGPW
    KYWRADGTLCNECIFVHGKPHGPFKRFHESGEVSQDGAFEQGNLHGPRTWYASDQFTTERMHENGVSEKVRRTVMVYANG
    RVTQVLHYNGAGERVVPSTGEPYPTRPANLPEKAEYREDQDQWASVSLNAKAERHGLCRFWDREGQLLWECEFHEGSRHG
    RYHSRAVDEYADPRVRFDEGEMEDDFACGTWKLLDAEGNAVVTRDLGVVQDHETLDASEVFSNLPRSAAEWRAFAEQARA
    DRRYREALLAMARASAVSLDAGPLKAWLESLTLPRTEASARENAEGVMNSAGDERAALADAMMRGAEAAMLLRGFAVLHD
    QQDRPRAALDFILAAMLLAPERSAYLFTRSLILANLGLGEQMQKDAEALAPAEPDSWKFLSAYRRVLFPRFEFWPGREPA
    HCTFDEVPDGPTKELDAVQAVVRKYATRLQLLRAEILSRFKPGTNVPWLPPDVSSLLPDGPVELEQTEVEDADGDSVDVD
    ETLSTKGMGIPALSRAARGDWSALTWLLWACGVDSIRMPDALTPPADFGQAAGQATQRLWQCRNRRSRGRIDPDLPTFDF
    EGVALQELHPNLAGIAEEQYAETQAMFFWLTDANHVSPWQANLRG

    >gi|108760220|ref|YP_630487.1| thioredoxin domain-containing protein [Myxococcus xanthus DK 1622]
    MAQSDTPVRLDVWSDYVCPFCYLELPVLEQLHARLGSALDIHWRAFELRPVPARPLAPVSEPPRSAWARSVYPLAEQRGL
    TMRPPPVQPKSRLALEAAEFAKDAGSFSPFHEALFRAFFADGQDIGDLRVLGALAEDVGMDRESMTRALEAGRYTARVLA
    DEEEAQRLGIRGVPAMRLAGNGPVLLLTGAQPEEAVRAAFARVRPGPSLSAVH

    >gi|108760081|ref|YP_630538.1| glutathione-disulfide reductase [Myxococcus xanthus DK 1622]
    MARYDFDLFTIGGGSGGVAASRRAGAHGAGVALCEDRDVGGTCVHRGCVPKKLLVYGAHFREEFQDAEGYGWTVQEPLFT
    WSKLLAAKDKELDRLRGVYARLLRDSGVTLLEGRGRVVDPHTVEVAGKLYTAERILIATGSRPYLPPDITGIEHAITSDE
    ALSFPELPRRLAVVGAGYIGVELAGVFHGLGSKVTMLIRGASVLGGFDDDVRSFLTDEMRKKGIELMTDTFIRDIEKRAE
    GGVSLLTGGGETVEADAVLFATGRVPNSGGLGLEEVGVTLDARGAVVVDAWSRTSVESIYAVGDITDRINLTPVAISEGR
    ALAETLFNDNPTQMDHTNVPSAVFSQPPVASVGLTEQEARERHGKLDIYVTSFRPMKHTLSGRNERTMMKVVVERESNRV
    LGCHMVGTDAPEIIQGLAVAVKCGVTKKQLDATVGIHPTAAEEFVTLRDKRPDPDERLAAELGRDAAASTRR

    >gi|108763223|ref|YP_630570.1| methionine-R-sulfoxide reductase [Myxococcus xanthus DK 1622]
    MVDKLTLSDDEWRKRLSPQEYEVLRRQGTERPGSGCFLGTKTPGTYVCAGCGNPLFKAGTKFESGTGWPSFTQPVAPDAV
    TEIQDVSHGMIRTEVRCARCDGHLGHVFPDGPPPTGLRY
    CMNSVSMKHVPEGQPLELVKT

    >gi|108759521|ref|YP_630609.1| glutathione peroxidase family protein [Myxococcus xanthus DK 1622]
    MKTLPLLTLASALAFTPALAAAPKPPPPAKSEPTSEKKPMSFHHLSANRLDGKPETLSGYQGKVVLVVNTASECGYTPQY
    AGLEKLHQEYKDKGLVVVGFPSNDFGGQEPGSSEEIKKFCELRYKVTFPMFEKVKTKGDGQSPVYAFLSQHHPAPKWNFH
    KYVVGKDGQVKAGFPSAVTPDSAELKAAIDSALAQP

    >gi|108758879|ref|YP_630807.1| molybdopterin biosynthesis protein MoeB [Myxococcus xanthus DK 1622]
    MGPAPGLYASDMARTFQTLLAGVKQEIREVSVDDVKRLLDARASVRLLDVREADEYAGGRLPGALHIPRGYLELRIESQV
    QRDEELVVY
    CAGGTRSALAAKTLKELGYERVASLAGGYNRWSDAALPVEKPFVLTAEQKERYRRHLSLPEVGEAGQAKLL
    QARVLLLGAGGLGSPAALYLAAAGVGTLGIVDSDVVDLSNLQRQVIHTRERQGQPKVASARAAIEALNPDVKVVGFEERL
    TSHNVLTILEGFDLVLDGGDNFPTRYLLNDACVMLGKPNVHGSIFRFEGQVTSFVPGQGPCYRCLYPAPPPPELAPS
    CAE
    AGVLGVLPGLIGLLQATEALKLILGQGAPLVGRLLTFDALGTRFQELKLRRDTQCPVCAPGATVELIDYERFCAAPTPA

    >gi|108763866|ref|YP_630808.1| HesB/YadR/YfhF family protein [Myxococcus xanthus DK 1622]
    MAVRLTDAAIQQVKSVITAQGFEGYFFSIRVVPAGCSGLGYDLNLVKESKAGDTVWEQDGVKIASDPMSSQYLGGTEIDY
    VSAITGSGFKFNNPNAKSSCGCGTSFTT

    >gi|108758006|ref|YP_630830.1| methylated-DNA--protein-cysteine methyltransferase [Myxococcus xanthus DK 1622]
    MTMPPPLRLLMDRAPTPIGSMLVVCDEAGSLRALDWEEYEPRMLRLLRLHYGVNGYVLEPASDPFGRTTAMQTYLRGDVS
    VIDSLPVATAGTPFQREVWRALRDIPAGATTSYGQLAQRIGRPKAVRAVGMANGANPIGVVVP
    CHRVVGANASLTGYGGG
    LERKQWLLDHERRHASRGTTRPPTR

    >gi|108762690|ref|YP_630871.1| thioredoxin [Myxococcus xanthus DK 1622]
    MAGADVTNIGDGDFKQQVLDSQEPVLVDFWATWCAPCRAIAPSIEALASQYKGQVKFAKLNIDENQDTPQEYGIRSIPTL
    LLFKGGRVVEQIVGAVPKARIEEAVKKALT

    >gi|108761309|ref|YP_630957.1| OsmC/Ohr family protein [Myxococcus xanthus DK 1622]
    MSPPQTPATGVVMTLVSQPQFKTQLTHGPSGTVNQTEAPRDNGGTGGSFSPTDLVGAALMSCAVTTMHLFASREGIALGE
    VSARVEKRMSPPPRRIAELVLDIQMPAGLSAEHRATLEKVGRECPVARSLHPDVKLPLTFSYPD

    >gi|108757923|ref|YP_631083.1| monooxygenase flavin-binding family protein [Myxococcus xanthus DK 1622]
    MTATKQEGRAFSPEALKEKYRLEREKRLRPDGNTQYIPVKGVFADFDKDPYVEPGFMRPALAEQLDVLIVGGGFGGMLSA
    ARLRQAGVDAIRIVEKGGDFGGTWYWNRYPGAACDVESYIYLPLLEETGYMPTEKYARAPEIFAHCQRIGRHFQLYEKAL
    FQTLVQSMDWDEDARRWNVTTDRGDRLAARFVIIAGGILHKAKLPGIPGIETFKGH
    CFHTSRWDYAYTGGSPTSRMTRLG
    DKRVGIIGTGATAVQAIPQLGAVSQQLYVFQRTPSSVGVRGNRPTDEAWAKSLQAGWQQDRIRNFSAIVSGRALPVDMVQ
    DGWTYIFQDGATQQARTPEEAVELRQLADYRKMEEIRARVDAIVSDAATAEALKPYYNPMCKRPCFHDEYLETFNRPNVQ
    LVDTEGKGVERMTPRGVVVKGEEYPVDCLIYASGFEVSGDYTRMLGFDIRGRDGTSLRESWADGPATLHGMHSRGFPNLL
    MFTTTQSGWAINFVHILDEQSQHAAYIIGRCLKQGVEVIEPSAQAQQQWWDVILSRLRMGISFGGADCTPGYYNNEGVSP
    GPNAIRYATFGGDTLAFIDVLRAWRQGDGLVGLELSQGKVASKP

    >gi|108758330|ref|YP_631257.1| hypothetical protein MXAN_3049 [Myxococcus xanthus DK 1622]
    MELWVTRRDPAEVTVEPIIVCAELYMRLGDDEVLVLDCRDAADWERYDLHIPGALRMTSAEIARDHHMLPDDELIVLCGC
    SPDGRDARRVCRLLRMKGREAVCLDGGLLAWVTGGFPTERHTRAPVAAIPR

    >gi|108760161|ref|YP_631329.1| putative arsenate reductase [Myxococcus xanthus DK 1622]
    MELWINPACSKCRAAMAAMDASGAAYVVRRYLESPPTAAELEAVLGRLGMEPWELVRMGEAAATKATLEMLPRDATHRAD
    WIAAMVQHPELIQRPIVTASDGTTVVGRSPEALERVLAAERSSGT

    >gi|108757235|ref|YP_631407.1| DSBA-like thioredoxin domain-containing protein [Myxococcus xanthus DK 1622]
    MVMKQNPLSFHPRAKPAAIAAMAAGEQGKYWEYHAKLFANQKKLDDVSLEQYAKELGLNLDKWKAELGNPKFQDIITRDQ
    ALAGQLGASGTPAFFINGRFLSGAQPIANFQALIDEELVKAENLVKGGVPASQVYAKIIEKGSERAAPKAQPQQPAATVR
    KVEIPSDSPSFGPANAKVTIVEWSDFE
    CPFCSRVGPTLSKIKESYAKDVRVVFRHQPLPFHPNAKLAAEASHAAHEQGKF
    WEYHDKLFANQKAMDRASLEKYAQELGLNVAKFKAALDSGKFKAKVEADMAAGNAVGANGTPTFFINGREFVGAQPFEAF
    KRVIDEEIGKADKLLAAGTKPEELYAKLNAENVANAPTAPAAAPGAPAEPPVQKVDVGNAPVKGDKNAPVTIVAFSDFE
    C
    PFCSRVVPTLKQLEDQYGGKIKVAFKNQPLPFHANAKLAAAAALAANEQGKFWEYHDKLFANQRALDRASLEKYAQELGL
    NVDKFKAALDQGKFNAQIEADMAQASSVGASGTPTFFINGRTLVGAQPVDAFKRVIDEELKKLGGAVADSK

    >gi|108758276|ref|YP_631451.1| thiol:disulfide interchange protein DsbE [Myxococcus xanthus DK 1622]
    MKGWRYTLGFVVLCAGLLFVLFKGFGRNPHEVPFMMKGKPAPDFGLRALDSGEKVSLADLKGRPVVINFWASWCGPCRVE
    HPVLEWGARQYGSQAVFLGVVFQDTDDNARGFLQQYGASFPQLVDPRSRMALDYGVAGVPETYFIDPNGIIRGKHVGPID
    PQTLALRIQELSTPSAPTEAARK

    >gi|108758957|ref|YP_631476.1| putative peroxidase [Myxococcus xanthus DK 1622]
    MARRGPCEHAGWTVQSAAAEGAVDRMHLKDVEDRESDGHYGRLIRMAREVGSPVPQIWHLFAYKPRLGEALSRFTHEVMR
    GPSPLSPGLRELIAAYTSRGNQCLF
    CTGSHAAVAAELLGNPDLVKAVLEDVATAPISEAEKALFAFVDTLNHRAAQVGRD
    DIAHLKDAGWTDEALFDTVTVCALFNFYNRWIDGTGVQDMPAEMYQRSGQRMAATGYAPPPPPAKPEE

    >gi|108757988|ref|YP_631619.1| copper-translocating P-type ATPase [Myxococcus xanthus DK 1622]
    MNAVEAASSRSPAGALERMDLAVSGMTCAACARRVERTLSEVEGVQECSVNFATRRASVLFDARATSVSALADAVADAGY
    RAEVPQASTAEETDAAEERGLRRRLAVAVLFGLPVVVLAMSHGALDFTGSIWVQLGLTVPVMAYSGGPIFRAAWAALRHR
    SADMNVLVALGTGAAFIFSVVATVWPTFMVTGDHGGHGGHGAAPPIYFEAAAAVIAFVLLGRFLESRARTRAGDAIRRLQ
    ALAPSIATVLENGVEREVPLAEVRVGDRVVVRPGQSIPVDGSVVDGASSVDESMLTGESLPVEKAAGAEVFAGTMNGTGR
    LVFRAAKVGSDTALQQIVQVVERAQGTKAPIARLADVVSGVFTPVVLLIAIATFAAWFVLAPEETRLTMALLNAVAVLVI
    ACPCALGLATPAALMVGMGRGAQLGVLVKSAASLEGASRIDTVVLDKTGTLTQGRPAVVRVLTASGMTEEEVLTLAAAAE
    SASEHPLARAVVSEASNRGLKVGTPESFTATPGHGVEAEVGGRKVLVGSRRMLDGRGVSGSEDAERVLTTDGQTPVLIAV
    DGRWVGAIGIADPEREEAATVVQSLRSMGLHVVMLTGDHEGPAARVARALGIDRVFAGVLPSGKAHVVRTLQAEGRRVAM
    VGDGINDAPALAEADLGVAMGTGTDVARDAAGVALLRSDLRGLPAALGLARTTMRVIRQNLFWAFLYNVLGIPVAAGLLY
    GLTGWLLSPMLASVAMSLSSVSVLLNSLRLRRLRLPAPQAA

    >gi|108757552|ref|YP_631624.1| mercury ion binding protein [Myxococcus xanthus DK 1622]
    MNPNDETLLKVEGMSCRSCVSHINTALRKVEGVQDVNVRFEQRQVLVKHDAATANVNILIEALRDAGYESAPTA

    >gi|108763115|ref|YP_631862.1| thioredoxin family protein [Myxococcus xanthus DK 1622]
    MRTPTALSLLLLGLSPLTWACKREPPPAYVRLQGTAPTVADVPPSRALLIVFWASWCPPCRQETPQLVALAQAPPEDLQV
    VVFSHDETPQAVESFFKGPPPTPLHLRLDVDKRAGDAFGADQLPVSVLLVDGRQVARFSGPREWDAGAMRRLLERLIREP
    SPSAPRPLD

    >gi|108761387|ref|YP_631889.1| thioredoxin family protein [Myxococcus xanthus DK 1622]
    MSRVLLRGAVVALVALAGCRGTRPVDAGYAFLNALALPSVGPTPHDVRALDGKVVLVSFFATWCFPCLAEMPTLEALQKD
    YGPRGFQVVAVGMDLEGEKVLAPFADHYALRYPVLVANQAMIEGHSAFGAIQGLPTTVLLDRRGRAVAGWHGVESHADMA
    KAVEKLLAQPE

    >gi|108763332|ref|YP_632247.1| ThiF/MoeZ/MoeB domain-containing protein [Myxococcus xanthus DK 1622]
    MHGHGTDHHPRIPHASRLERARVLLVGAGGLGCPASLALAQAGVGHLTLADPDCVDVTNLPRQLWHRGEDVGRNKAESAT
    AGLARAFPGLSTEAIPERVDASNAEGLFRAHDAVIDATDGVATKFFLSDVAVLTGVPLIYGGVLRMQGQAMRVDPGGPCL
    RCLYEAPPPPDAVPT
    CAQAGVLGSLAGLVGAVQALLALELLSGAARGGQGEATLHVLDAVSILGRRTRVARAPDCEGCRV
    TAIPAYPESPEACAT

    >gi|108758911|ref|YP_632394.1| alpha keto acid dehydrogenase complex, E3 component, lipoamide dehydrogenase [Myxococcus xanthus DK 1622]
    MAETFDVVIIGSGPGGYVGAIRAGQLGLKTAIIEKDKRLGGTCLHRGCIPTKSLLWTAELFHHVREAADFGVDVSSPAIN
    WPNAMKHKDKIVTKGANGIDFLMKKNKVTVVKGHGRIAGKGKVEVTAADGSKQVLEAKNIILATGSVPKSLPNVPVDHKR
    VLNSDSILQIDRVPKSIIVLGAGAVGCEFASVFNHVGSKTSIVEYMPALLPIEDADISKELEKIFKRRGIDVHTGSAVEK
    VEHTADGVRVTMKVGNETKTLEAEILLSAVGRSPVTEDVGLDKTNIQAERGYIKVDSMLRTSEPNVYAVGDIIPTPMLAH
    MASAECVVAVEHIAGKNPQPINYDLTPSATYCYPEVASVGLTEKKAKERGYDVKVGIAPMGAVTKASISNEATGMIKIVS
    DRKYDEVLGVHLIGPHATELLAEACVALKLEITTEELANTIHAHPTLSEIVHEGAEATLGHPRHF

    >gi|108759677|ref|YP_632489.1| rhodanese-like domain-containing protein [Myxococcus xanthus DK 1622]
    MKVIFVVAAAVFMGLFFTACTRPRPGDAAVGSEARRRVEAGATLVDVRTPEEFASGHLPGAVNIPVDELARRFGELGSLQ
    TPLVVY
    CRSGARSGRAERLLKEQGFQDVFNLGPMSTWP

    >gi|108757932|ref|YP_632495.1| hypothetical protein MXAN_4320 [Myxococcus xanthus DK 1622]
    MTLRPYQDITPSQLDTLGPEVRRIDVREPDEYTGPLGHLPGAELIPLATLEAAASAWPREAPLLLICRSGGRSAQAARLL
    AHGGFKHLFNLAGGMLAVREPLAPRPQG

    >gi|108762562|ref|YP_632527.1| OsmC-like protein [Myxococcus xanthus DK 1622]
    MTTHSQTEKPGAFRQVLKTGTHTLHADVAPALGGEDSAPGPHDYFDAALAACKALTATWYAKRHGLALERVETHVERDDS
    RERQGTYTLKVKLAFHGALSPADKQRLYNAVAQCPIHKLMTTSTVDIVTEPLEA

    >gi|108763140|ref|YP_632977.1| hypothetical protein MXAN_4816 [Myxococcus xanthus DK 1622]
    MHMQGGAGMLARLKSTWARARERRWVRWGVDLAVFALLFSAVAAWQARNLPGAGTPAPAFTLQTLTGDTVRLDALRGKPV
    VLAFWAPW
    CGVCGMESSNLSQLRKLAGDSAHVVSVAVAYEDEEAVRRFAQEHAVDYPVLLGDDAIQSAFRVNSFPTVFFI
    SSEGRVERAAVGYTTLAGLFWRMVL

    >gi|108759226|ref|YP_633053.1| GrxC family glutaredoxin [Myxococcus xanthus DK 1622]
    MKPVKIFTTTYCGFCVRAKDLLKRKGVDFEEVDVTGDDDLRAKLVEMSGGQRTVPQIFIGDTHVGGYSDLSRLDTEGRLE
    PMLQA

    >gi|108762810|ref|YP_633122.1| putative lipoprotein [Myxococcus xanthus DK 1622]
    MLNRPTRVILAALLAASFTAGCNKEKAPATAPAAQQAAGEPAPDTVVATFGDGQKITYKELSERLQEPLANLEKQKSQLL
    KRGLDGMVTEKLVDAEAKKRGLSQEAYLKAEIDDKVPAPTEERIKEVYDGAAGQLPEGSTYEQMKPQIVEFLTQQPKQER
    AQALFEELRKSANVKLTLPEPPRPPVVRKQVAATGAAKGGPEGAPVTIVEFSDFQ
    CPFCSRANPALAQVQQEYGDKVRIV
    FRHFPLDFHKEAPKASEASLCAGDQGKFWEMHDLLFANQQALGVDSLKKYAADLQLDTAKFNACLDSGEKGAIVQKDLAE
    GKQAGVSGTPAFFINGILLSGAQPFEEFKSIIDAELNAPKK

    >gi|108759425|ref|YP_633155.1| thiol:disulfide interchange protein DsbD [Myxococcus xanthus DK 1622]
    MPLQRSSPWPPACVYKGGLGARSHARMDAKKLGVMAVLAGVAVAVVPWLLPTGPNANLDAARFLEAGSLAVGAAVVFAGG
    LLTALTPCVYPLIPITVSVFGARKTEGRGRALLLTSSYIVGMGVVFSALGVLAAKTGQAFGSMLGHPAVVTGLAVFLLLL
    ATSMFGAFELALPSSFQTKLNAVGGAGVAGAFLMGSVSGFLAAPCTGPVLTGLLAFVAKSANTTLGASLLFVYALGIGVP
    FFLIGVFTVRLPRGGVWMEWVKSVLGIMLVALAFSYLKDAFPWARDVVKGLGLHVGRVPGAVIAALLVAVGVALGAVHRS
    FKEGAREFSFKALGVALVVAALVLRGGALDGGPVGTLWVSLGLAEPARAPAWQWHHVMPAKQATFSPEAFDQVLAQAKAE
    GRPVLIDFFADW
    CAACKELDRDTYPAQQVISESDEGRFLNIKIDATNSEDSLDALLERFGVEGLPTVAFISPEGKVLTQP
    RVTGFLAPSPFATEMKKARCTDANAC

    >gi|108760194|ref|YP_633159.1| iron-sulfur cluster assembly accessory protein [Myxococcus xanthus DK 1622]
    MAKPPKGITIADSAVARLKELLEQRQTPEAGLRLAVKGGGCSGLQYSMEWSEKSRERDKIFEKDGVRVFVDPKSYLYLIG
    TELVFEQTLMASGFKLDNPNIKAACGCGESFSV

    >gi|108762722|ref|YP_633350.1| thioredoxin domain-containing protein [Myxococcus xanthus DK 1622]
    MDPATAVSGIPGMDFSSLSPTAKRELATVFNDEFCYCGCPHTLGACLKSHTPCKHARRMAQLAARRVSEGSPATEVILSL
    STYYSAFRDPRAQFKVDDRMCMGPAGAPVTVVEFSDFE
    CPYCAKARPVLEAFAKKHAQQVRFCYLPFPLSMHANAKPAAQ
    AALWARDQGKFWQMHDALFEHQSNLKPDAIAALATSLGLDGAKLAALLKTDAYKEELDGYRSQGRAAGISGTPSVYFNGR
    ALDLSFVEAEMLSHSLEDELEWSANKNAWAAD

    >gi|108762125|ref|YP_633575.1| metallo-beta-lactamase family protein [Myxococcus xanthus DK 1622]
    MYFQAIKTAGLAQITYILGSEGEALVVDPRRDVDVYLDVLRRQELRLRYVLQTHRQEDFVEGTSALARLAGAQVVAGRHP
    ITGHADVRMGERERLHLGALTLVALHTPGHTPESMSWAVYLDPHHAQAWGVFTGDALLAGETGRTDLAAPERVYENAALL
    FDSLHQKVLPLGDQTLVFPAHGAGSVCRSGIADRELTTLGFERLHNPVFTSSRSDFIQRKVQERLHRPSYFSRMEEVNIR
    GGVPLSADSSAIPFLEPKRFQWESHSGLVLDVREPESFAGGHIPGSLNVWMQGLSVFGGQMVQPGTPLFLVLPAHVDSKE
    AVLALARVGLDQVEGILTGGFGAWRNAGLPIESSGTLTPEALFSQWEGFQVLDVRERSEFERGHILSARHAYVTELEECL
    SELGLREDHPVAVV
    CSTGHRSGLATSILLRNGFQQVSNVLGGMSAWRRLELPVRTGPPSEVEFEQATRSMGTEEQDASPP
    SPS

    >gi|108758131|ref|YP_633639.1| ArsC family protein [Myxococcus xanthus DK 1622]
    MAKDVLVLSYSGCGTCKKALKWLQEQGIAHQVRPIVEMPPTVAELKQWIARSGVSVRKWLNTSGQSYRALGKAKVDAASD
    AELVEWLAADGKLVKRPVLVTGDTVLVGFKPEAYEQHFASRG

    >gi|108760534|ref|YP_633682.1| P-type ATPase [Myxococcus xanthus DK 1622]
    MPASTTSEPAPTACLHCGSPVPSGGAARDFCCVGCEAVHGLLVEQGLTRYYQLAQGKTAPAPEPRKERAFAWLEPLMSRA
    ESTPGPLCALELDVQGIH
    CAACVWLMNELFRRQPGGAGLTVDPALGKVRMLWRRGAFDVAEFLRGVEGFGYLFGPSRKRP
    ERTSLDLPIRLGICAALSMNVMLFSVSFYVGLTPEDGDVFRLFTRLSLWLSSAVVVVGGWPFFRSALQGLRRGVLHLDLP
    IALGILLVFGMSLAQARGGRGDLAYFDTLNTFVTLMLVGRWLQQRVLERNRRFLLDDDGAEGLFVRREEGARLATVRAAE
    VADGDVLVIAPGDLVPVDAVLLDSGARVSTDWITGEPGERAVGQGGALPAGAFNAGREAVRIQAKQAFTDSPLVALLRRA
    PTAAGGPALHTRFWDRVSRRWVVTVLFVSALGLALWWPAGPDKALEVAVALLVVTCPCAIGIATPLAYELVQARLRRGGF
    FIRSTDLLDRLPRVRKVLFDKTGTLTLGRLELVDRAAVAGLTAASRDIAFDLVSRSNHPASRCLAAALAREGARFNSEAR
    VSELAGQGLELNREGVRWRLGRADWATEAVDTGHPEREPTDGASCAGGSPASRHSRPSGRVEVLLSGSGLAAGPVLTRDG
    VPVAFFQLRESVRPDARREVQALQGEGREVWLISGDSHGRVSDMAAALGIPTQHTLSGQRPEDKAEAVAKLDAADTLYLG
    DGVNDSLAFERALCAGTPAIDRPVMPGKSDFFLLGEGLGAIREALRLSARLRQVVRRLLLLAVSYNVVAVAVCLAGWMTP
    LRAAVAMPATSLATVLFTVWWLSASRERAAASPTPPLREVPA

    >gi|108757522|ref|YP_633808.1| thioredoxin [Myxococcus xanthus DK 1622]
    MATIDITKANFKEIVSKEGIVLLDWWAEWCAPCRTFSPVFEQASTKNPDLVFGKLDTDAEVELAGAFAIRSIPTLMVFRD
    GIMLFEQAGALPANALDDLIRQVRALDMNEVRKQLVDRQAQQGAPSQA

    >gi|108758850|ref|YP_633827.1| putative lipoprotein [Myxococcus xanthus DK 1622]
    MNPMRAFLAAALLAASLAGCARKDPPPKPAEADASSSPATAAAKPAAAASQGSGAILFLSADTRGYLGPCGCSENMRGGI
    ARAAAQVQSARKGSLPVLYVDGGNSLFGEQRLKPGQVPQEERKAKALADAMRHMGLAVRATGPLDDTQGVDFRKGLGLPE
    LAPGAVKLLPAGERKVGVVAATTAAQLAEASAQARAQGADFVVGLLDVTLDVAQQAVEQPGLKADVVVATRTATEFSGEE
    NRLVRSAVPVVALQSKGRSLLRVDLAYAPQAGPFALQKGQDDLEREAAALEQRTALLDKDINLPGTDPKLKALKQGKRDE
    LVARRQALLDAPPVTSDGVNAFTLRFVPLESSLPSDAEAVALVSAYDADVGKMNLAWAKAHGQDCLPPAPGRAAFVGNEP
    CRTCHEDAFPVWKKSKHHLAWETLEQVGKQFHLNCVGCHVTGWEQPGGVCRLDKVAGREDVGCESCHGPGSEHADAPGTH
    NIIASPGESVCVTCHNPENSPHFDFATYLPRIVGPGHGKP

    >gi|108760938|ref|YP_634036.1| ADA regulatory protein [Myxococcus xanthus DK 1622]
    MLHHVLADIRFREAHPRSIGMASSDYARIEQAILYLDAHAREQPSLDDVAAHVGLSTFHFQRLFSRWAGISPKRFIQVHT
    LSSARRLLDERRSVLETSLEVGLSGSGRLHELFVTLTSMTPGEYKLGGEGLTVRHGVHLSPFGACLLAVCERGICSLHFL
    AGESEEEALASLRKQWPRATFEASAEDTAPWMERIFQAGHGGSESSPLSVLVRGTPFQVQVWQALLRVPSGEVTTYEDLA
    RAIGKPKAMRAVGSAVGENPVGLLIP
    CHRVLRKTGVFGEYRWGASRKRAMLAWEDLRYDGAPLSGM

    >gi|108757716|ref|YP_634091.1| hypothetical protein MXAN_5954 [Myxococcus xanthus DK 1622]
    MATPPPSVDTSNRLAREPSPYLRQHAHNPVDWFPWGEEALAKAKAENKPILLSVGYSACHWCHVMAHESFESPETARLMN
    EGFINIKVDREERPDLDQIYQGVVQLMGQGGGWPLTVFLTPDLKPFYGGTYFPPQDRYGRPGFPRLLMALRDAWENKQDE
    VQRQSGQFEEGLGELATYGLEAAPAVLTAADVVGMGQRMAKQVDAVHGGFGGAPKFPNPMNFALMLRAWRRGGGAPLKDA
    VFLTLERMALGGIYDQLGGGFHRYSVDERWLVPHFEKMLYDNAQLLHLYAQAQQVEPRQLWRKVVEETVAYVRREMTDAG
    GGFYAAQDADSEGEEGKFFVWRPEEVRAALPEAQAELVLRHFGIKPGGNFEHGATVLEVVVPVSELARERGVSEDAMERE
    LAAAKQTLFDARERRVKPGRDDKLLSGWNGLMIRGLALASRVFGRPEWAKWAADAADFVLEKAWDGTRLARSYQEGQARI
    DGFLEDYGDLASGLTALYQATFDVKYLEAADALVRRAVDLFWDAEKAAYLTAPRGQRDLVVATYGLFDNAFPSGASTLTE
    AQVELAALTGDKQHLELPERYVARMHDGLVRNTMGYGYLGLAADALLEGAASVTVAGASDDVAPLRAAMDRAFAPTVALA
    WKAPGQPVPALLQGTFEGREPVKGRAAAYLCRGFVCELPVTEPDVLTQRLAALTGP

    >gi|108761509|ref|YP_634287.1| cytochrome c biogenesis protein/thioredoxin [Myxococcus xanthus DK 1622]
    MSLGLPGIFLAGLLTFLSPCVLPLVPLYLSFLAGVSLSQLREAGSGVRRPWGVALAFSLGLGSVFVALGMAATAMGGLLA
    EHRSGLLQFGGLALFLLGLKQLGFIQIPWMDGEVRPLLGRVRRGGSLLGAFLFGAAFALGWTPCIGPVLGGVLTYTASST
    SEPLMGALYLGTYAAGLSVPLLLVAAAAPLALRWMERAKRHLRKFEVATGVLLAGLGVLLFTDSLELLVPSAEGGEASAP
    VMERRASSSPAASETACTSEEGGDGTCALPEEGGVPSFIGPSALARVERPTMVEFVSQS
    CPVCQRMEPTVALAEQHCSGK
    GVEVLRLDVGTAAGRRAAVQYGVRGVPTFLFLDAAGQEVARRVGEQSLTSLWQGLEVIAGGRCAGLLP

    >gi|108762397|ref|YP_634435.1| AhpC/TSA family protein [Myxococcus xanthus DK 1622]
    MLVPLLVAGFFSGAIPQAGETAPDFTAKDSAGNVYTLSEMVKRGPVILAFFPKAFTGGCTRELKAYRDRYADVEKAQGQV
    LAISMDDAESLTRFKAELKAPFPFIPDPEGKVVSAYDVKMPLLSVPKRYTFVVGEGLKILKVESGNDAINPHGAIVACPL
    RKPAGADAKTPDSGTK

    >gi|108757090|ref|YP_634464.1| vitamin K epoxide reductase family/thioredoxin domain-containing protein [Myxococcus xanthus DK 1622]
    MATRGALALLVLGLAESGLSIFQWMQLLTLRGGGSTVCGVSDTVNCETVWNSAFASRVHDLVGLPVAALGLVWGLVAVGL
    SALFLAWARSGRPVRPAANGLRLVAAAGLVSVVVFAVASAQSGALCPTCLATYALVVAFAGVAWKGLPGPLLPGAGEWGA
    TLKWTAGVTAAVFLATLLPGRATPKASDASGAALLPPAPQVASTQTPGVTPQTPPPPPASLEEFLRSLPPQHQQFMADAL
    AAYRSGTPQPAASPARHRYGPVDAPVKIVEWTDSK
    CPHCKMLVEELSALKKRVPEGKMSLEARQFPLDGACNPAIPRRGP
    DAPSVRCVAARAQICLEGAPDYWELREKMFAAQAVLDTERAVEIASSGSVPRSQLEVCMNSPATAAKIQEDSRYAMRHHI
    QGTPLVLVNGRETAPSAPFLYALVMAEGNPSAPGFDVLPPPRPRPVGGHGHGHDDHAGHNH

    >gi|108757097|ref|YP_634591.1| thioredoxin [Myxococcus xanthus DK 1622]
    MTTNVISLDDAHFQREVLESSEPVLVDFTATWCPPCRALALVLDAIAADFRGRLKVTSLNVDDNPESAMRYGVRAVPALL
    LFKEGKVVRQMLGAQPRAKLEQELRTHLG

    >gi|108759791|ref|YP_634619.1| thiol peroxidase [Myxococcus xanthus DK 1622]
    MAEHKGIVTFKGQPVTLVGDEVKVGDAAPDFTVFKGLNDAVRLSDVKGSVVVVSVAPSVDTRVCAAQLRAFNKEATALGP
    DVKVWFVTLDLPFALGRFIGAEGIQNVTTLSDYKDREFGEKYGVYMKELGLLARSTFVVDREGKVVFREIVPEMTHEPDY
    DGAMKAVRAAL

    >gi|108763500|ref|YP_634658.1| anti-oxidant AhpCTSA family protein [Myxococcus xanthus DK 1622]
    MAKTKLLKQGDAVPDITLTGAGGQSVRLRDLVGQKVLVVYFYPKDDSPGCTAQACGLRDQYEDFVAAGAEVVGISGDSVG
    SHEGFAAKHRLPFKLLSDARGEAREAFGVSSSFLGLLPGRVTFVVDRSGIVRDSFESQIRVGEHVRRALELVRALAQEGG
    APASAAK

    >gi|108759432|ref|YP_634721.1| thioredoxin domain-containing protein [Myxococcus xanthus DK 1622]
    MTRRFDAVRHGPMSEPITVRVWSDYVCPWCYVGYAEVQKLKKEYDVQVDWRPFYLRPETPPEGLPLPDYVREKMKDPNNP
    LKLRAQAAGLTLVMRELTPSTRRAHEATEYAREQGRLEPFHAALLRRYWSEGQDLWQWDTLRGAAQEAGLDPDAVQRVVE
    EGRYTKAVEDSIQEARTIGVNAVPTFVLGERFGLQGAQEYSVFQEAMRRLGATPRAQP

    >gi|108760609|ref|YP_634742.1| AhpC/TSA family protein [Myxococcus xanthus DK 1622]
    MPMPQAGDQAPAFQLADQDGNAVSLAQFAGRSVVLYFYPKDDTPGCTVEACGFRDEHSALEAAGAVVLGVSADSTASHRK
    FATKFNLPFPLLADVDHTLSEAYGVWGEKSLYGRKFLGITRATFLIGPDGVLKQVWPKVKVNGHVAEVLAVLKGEAPAAG
    GAVKKSAAKKAPAGKKVAAAKKAPAGKTVSGKSAATRKATAKKAAPAAKAPRAAKKAATAKKAPVAKKPAAAKKASAGKK
    PAAAKKASAGKKPAPAKKSAVAKKSAAAKKASRK

    >gi|108757319|ref|YP_634899.1| selenocysteine-containing [Myxococcus xanthus DK 1622]
    MVVARTKLGSWGAHAVCPAHVRRMAMADPKVTITYCTACGYRPRAARAAAALKDELDVEAELLPGPSGSYEVAVDGKVVI
    RKASLAFPTDHEVVDAVAKVLGR

    >gi|108762614|ref|YP_634965.1| thioredoxin [Myxococcus xanthus DK 1622]
    MAAVEITKDNFKETVSKEGIVILDWWASWCGPCRAFAPIFEQTSNNHPDIVFGKIDTDAQQELSGAFEIRSIPTLMVFRD
    GILLFEQPGALPAAALEDLLKQVKALDMEQVRKEVAAKRGEPPQA

    >gi|161598324|ref|YP_634981.2| bifunctional methionine sulfoxide reductase B/A protein [Myxococcus xanthus DK 1622]
    MLSACTEARGAAPAAPGPTIQDTRRYEKPSDADLRRTLSPLAYEVTQKGATEPAFRNPLWNHHEEGLYVDVVSGEPLFSS
    RDKFDSGTGWPSFTRPVDSARIVEKRDSTQGMERVEVRSKAAGSHLGHLFGDGPAPAKTRY
    CINSAALRFVAVNDLAKEG
    YGAWLPLFGRPAPAAATKRQDTSPFTETALLAGG
    CFWGMEDLLRKIPGVVQTEVGYTGGSSAFRNPTYHDVSSDKTGHAE
    AVRVVFDPTRLTYETLLEQWFFRMHDPTTLNRQGNDVGTQYRSAIFYLSDAQKRVAEEVKARVDASRKWPRPVVTQIVSA
    GAFTPAEDYHQDYLVKNPGGYTCHYMRD

    >gi|108756889|ref|YP_635006.1| TPR repeat-containing protein [Myxococcus xanthus DK 1622]
    MRLLAACLLLSGLVACTAANTNAPAAAASHAKGPLPFIEDDYARALAEAQAKGLPLFVDVWAPWCHTCRSMKAYVLSDAS
    LARHADRFVWLEVNTDLTSNAAFQEKYPVEFWPTLYVIDPRQEKALLRFAGSATVAQLEKLFEDGERAYKGGVTGAEALL
    ARGDALYAEGRSAEAAETLVEALAEAPADWSRRGRAVESLLTAMYGAKQHEACAHKALEELPKTPRSLSWANGALLGMYC
    VLSLPEDHAAGAELRGGLEAKVAEALAPPAIEMSADDRSGLYEVRVQAREVAKDTAAVKALSEEWLAFLEGEAAKAPNPQ
    ARTVFDSHRMLAAMKLETPARAIPALEQSEKDLPQDYNPPARLSTLYRLVGRLDDALAASDRALARVQGARRLSVLSGRA
    DILVARQDTASAVKTLEEAITFAKSLPASQVSPRTVAGLEKKLSGLQASAR

    >gi|108760437|ref|YP_635045.1| thioredoxin [Myxococcus xanthus DK 1622]
    MAHPVSYEGTAENFDQLVLEPKGELVVVDFWGDGCPNCEIYAAAEPALLAELGDAPMRVVKVNAYQYEDLAKRFGLFGIP
    TFLLFREGKLIGKMSQYYGKEYWLGVVRDHLPQA

    >gi|108756918|ref|YP_635173.1| methionine-S-sulfoxide reductase [Myxococcus xanthus DK 1622]
    MFFNPTKKLRIPTPEEALPGRSDVMPVPEKHEVLGTPIKGPVPEGLEEVYFGLGCFWGAERKFYQTPGVYSTAVGYAGGP
    TPNPTYREVCSGLTGHNEVVRVVFDPKKVSFEQLLRVFWESHDPTQGMRQGNDVGTQYRSGIYFTSEAQQRAAVASRDAY
    QKALAARGFDAITTELLPAPPFYFAEDYHQQYLEKNPGGYCGLGGTGVSCPVGVGVNA

    >gi|108758673|ref|YP_635203.1| glutathione peroxidase family protein [Myxococcus xanthus DK 1622]
    MSQNLYDIPLKSIDGAPQSLGQFKGKVLLVVNVASKCGLTPQYEGLEKLYERKRAEGFEVLGFPANNFLGQEPGSESEIK
    AFCTLTYDVKFPLFSKISVVGADKHPLYHALTGAIPDAVGEGPMRSRLQGYGITANPVPEVQWNFEKFLVGRDGRVAARF
    APDVAADDARLLSAIDAELAKQA

    >gi|108757692|ref|YP_635265.1| OsmC-like family protein [Myxococcus xanthus DK 1622]
    MGARDVALRGAEGSVVTARLDLPPGRPVASAVRVGCFACLGPSPAPSRLAHALVARGFAVLSLDFTAPAAAGPRPDTVPS
    VEAVEAAAAWLRERYPPVRLLVGHSLGGTAAAAALPRLSEVAALALVNAPVGGGPLLERLSSTAREAGEGELDFGPGRLR
    LTRRFLQDIDEAHLRRALNAFPGELLVLHAPADRYVPLEHARRWMAMARRPASLMLLEGADHFLSHDADAGHAADVLGVW
    AARQVTPVREREAPLPPGVVEVHEAGEGRFAQDIRVGAHRLRSDEPLSVGGEDTGPTPYGLLTAALGA
    CTAMTLRLYAAR
    KGWPLEHVHVRLSHEKVHAKACEECETKDGKMDRLQRTVKLEGPLTDAQRATLVAIADRCPVHRTLASDVDVHTDVEQ

    >gi|108760353|ref|YP_635417.1| thioredoxin domain-containing protein [Myxococcus xanthus DK 1622]
    MSKSSVWVSLSVGLALGFAGGRLARPTELATGTAHAANLAAKAPAPGARPRAPISPTVYKVPVNDSPTAGAEDALVTLVE
    FSDYE
    CPFCSRANGTVKQLQERYGRKLRVVMKHHPLANHPRARPAALAALAAGEQGKFWEMHEALFANPRALSEADMERY
    AMKVGLNISRWNQDRADPRLAERIRQDEALAMRLGATGTPAFYVNGRFISGAQPLEVFTGVVDEELSKAEALVRTGVRPT
    EVYARTISAGKDSPPMEQMMPEEPAIQQVDVGTAPTRGPANAPVTVVAFSDFE
    CPFCARVVPTMKALEAAYPGKLRVAFK
    HQPLAQHANAQVAAEAAMEAHAQGRFWEFHDVLFANQRKLDRASLEHYARQVGLDVGRFNAALDSRKHDAHVSADVAQAM
    RVGATGTPTFFINGRPVTGARPVEHFRAIIDDELRKAAR

    >gi|108756792|ref|YP_633375.1| hypothetical protein MXAN_5223 [Myxococcus xanthus DK 1622]
    MEQRLDFPQKSSSAYQAMLGLERFVRNCGLEHPLLDLVKTRASQLNGCAYCIDMHTKDARVAGETEQRLYGLSAWRETPF
    YTERERAALEWTEALTLISQNDVTDELYDRVRQHFSEEELVSLTMAVITINGWNRIAIPFRSVPGSYQPPARAAAHP