Mycoplasma synoviae 53 uid58061

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|71894175|ref|YP_278283.1| putative mercuric reductase [Mycoplasma synoviae 53]
    MKKYDVIIIGWGKGGKTLANKLGLSNKKVAIIEKDPKMVGGTCINVGCLPTKSYTHYSHVFVESSKLGYKTSYETGKKAY
    VKTLKHKLEFVKKLNQKNFELLNKNKNVDIYMGSAKFLSDYEVEVNLNSNKKKVKLTAKNIIIGTGSVSRKLNIEGAAKS
    RFVKYSNDILNLRTLPKKLLVVGAGFIGLEFASYFANFGTQVTVAQYNNDFMPNEDKEDSKFILDTLKKQGIKFEFNTTC
    EKFKDLKSQVQVSLSNKTKKYKEKFDAVLISAGRIPNTLNLGLENTKIKVLDNKAIEVNKYLQTNVKGIYAIGDVKGGPM
    FTYISLDDYRIVSDQLLKTKKNRNLDNRPLVPTNVFIRPSFARVGLNLKQAKELNLQGCYAKTILTSSIPKAHVINELEG
    FNKLIFNKQNQLIGVSLFSYVAHEIVNVFSLMIQNKMTFEEIKDYIYSHPVYTEMLNDL

    >gi|71894297|ref|YP_278405.1| dihydrolipoamide dehydrogenase [Mycoplasma synoviae 53]
    MYTFKFADIGEGLHEGVVAEIYVKVGQQVKEGDNLFSVETDKVTSDIPSPVSGTVTAIKMAQGDTIHVGQDIFVFDDGKG
    DAPVAEAPAPKAEGEEEAASVVGEVKVNNDLIDFSKMFSGQPAPKAEEVKPSAAPAPSAEDKTFDEGKKYTGKVDESYDV
    IVVGSGPGGYLAAEEAGKAGLKTLIVEKKYWGGV
    CLNTGCIPTKTLLKSADVISYLEHAADYGIVAEKAKIDFSKSWVKM
    HQRKADVVKKISSSVEMLMKMSKVTSVFGEAKFVGARALEVNGKVYEAKNVILATGSTANKLLKVPGFESGYKSGEILTS
    EEAINFDKKLPKKVTIVGGGVIGIEFANVFAKAGSKVTVVQNGPVLLPGMDSDVSKLAKEMLEGMGVEVLLNANTLGYEK
    KTLKVEVDSKTLSLKQDVVLTAIGRSANAINAAEVGVKLGERGEVLVDSLQRTNVAGVYAIGDVTNQKMLAHVAYAHALV
    AVFHILGDKQKGSYHPKAVPGCVYTSPEIAFIGMTEAEAKAQGRNVMTAKYSFANLGKAIASNKTKGLVKLVVDKEFGEI
    LGAWMVGENVTDYIAEVAMAMENEISVHEIAHTIHPHPTYNEMIWEAARSASLTLTLAAMKK

    >gi|71894383|ref|YP_278491.1| thiol peroxidase [Mycoplasma synoviae 53]
    MKVKFGDKELTLNGLAPKHGDKVEAKGALAGSFDQVKFDNKGKMTVLSTFPSIDTKVCDLQVGKLAHLSEKYTDFNFVSF
    SLDLPPALADYKANHPTGRVEMYSDYFDKKTVSSLGMLINELQLATRAVFVLDKENKLVYSEVKDQVKDQVDFDALEEVL
    KKY

    >gi|71894533|ref|YP_278641.1| NADH oxidase [Mycoplasma synoviae 53]
    MIVVGANHAGTSFLRTLKTVNPSAEVVAYDRNTNVSFLGCGIAVWVGGMFKDPAGLFYSSPEVLTKEYGVKLHTQHDVVK
    IDRKSKKVVVKDLQTGREFEDSYDKLVFAGGTWPIVPPFKGKDLKNVLLSKLFQHAEEIITKAKDPNVKNVVVVGAGYIG
    VELVEAFHVRGKNVTLIDVQDRVVPNYFDPEFTDKMEENMRKGGVNLRLGESVEEFTSKDGVHVSGVKTNKDSYDADLVL
    LCIGFRPQTAVVEDVEKLPNGAIKVDEYQRSVSDENVYVIGDSASLKNVITNDYAHVALATNAVKTGIVAALHLAGMDVK
    FPGVVGTNAVSVFDCKYASTGFTKRLGEKNGLENLAEVYFEDNDRPEFMAHYEKVACKIVYDTKTLKLVGAQVGSWGQDS
    HAEIIYMLALAIQRGLTLPELALTDVFFLPHFNKPFNFVLVPVLRALGLKYKA

    >gi|71894606|ref|YP_278714.1| thioredoxin reductase [Mycoplasma synoviae 53]
    MMQNEKYDLLIIGSGPAGLNAALYASRANLKVGFVEKGAPGGKLSTTSKVENWLGTKMIDGAALALEFFDHAQAYGAQYI
    YGEVASIKSHSLFDKEVLLKDGKVLKAKTILIATGMVNRVPTFIKNIDSFLNRGVSF
    CAICDGPLYGKNPTIVLGGGNSA
    VEESAYLSKIASEVHLVVKEASFRAEPSLVDDLKKLPNVHIYMESEIKELRGESNLESAVIVDKNGVEKEIKVASFFPYI
    GFIPAADFAKELNILDDKGFIPTNESMETSVRGIFAAGDIRSKEIRQIITAASEGAMAAKKISDLLNSSN

    >gi|71894655|ref|YP_278763.1| putative thioredoxin [Mycoplasma synoviae 53]
    MTRLKWAEAQELVKNNKDSDLLFLEFTTDWCGDCKMMKPVVTKLASSFSEEDNIKFVNVDAEEAQLFRNPDSRWQVLKVP
    THILLKGQEIVEKAYEYVPGEVLKTWIEQRISK

    >gi|71894665|ref|YP_278773.1| thioredoxin [Mycoplasma synoviae 53]
    MVHNTTKNSLPENFNSGLKVLVFHASWCGACKMLSPVLDRLAQEDSYEVFKVNIDEDKAFAKELGVSSIPSVFVYKNGQV
    VANWVGYQPYEVMKKNLEALR