Aromatoleum aromaticum EbN1 uid58231

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|56475507|ref|YP_157096.1| pyruvate dehydrogenase multienzyme complex,dihydrolipoamide dehydrogenase component [Aromatoleum aromaticum EbN1]
    MSQIVEVKVPDIGDFSDVPVIELFVKPGDSIKVDESICTLESDKATMDVPSSAEGVIREVLVKVGDRVGEGAVLLKVEPQ
    GAGAAPAGAGEAKPVPAAAAPAASPSPSAAAPAQTAAKSGAYAGSVDLECDMLVLGAGPGGYSAAFRAADLGLKTVIVER
    YATLGGV
    CLNVGCIPSKALLHVAQVMDEAEHMAVAGIKFAKPEVDLDALRAHKDKVVGKLTAGLAGMAKGRKVEVVRGLG
    TFLDANHLEVELSSGSGQDKTGEKKVVRFKQCIIAAGSAAVHLPFIPKDPRIVDSTGALELRTSDGKAPAKMLVIGGGII
    GLEMATVYSTLGTRVDVVEMLDALMQGPDRDAVKVWEKQNAQRFDNIMLKTKTVAVEAKDDGLWVTFEGEKAPQGPQRYD
    MILQAAGRSPNGKKIGADRAGVVVTDRGFIEVDAQMRTNVPHIFAIGDVNGNPMLAHKAVHEGHVAAEVAAGETQGKSEL
    ARSAFDATVIPSVAYTHPEVAWVGFTEEQAKKEGRKVETAKFPWAASGRAIANGADYGFTKLIFDAETHRIIGGAIVGPS
    AGDMIGEVCLAIEMGADAVDIGRTIHPHPTLGETIGLAGEVAHGSCTDIPPMRKK

    >gi|56475657|ref|YP_157246.1| disulfide bond isomerase [Aromatoleum aromaticum EbN1]
    MTVTHSQTYATLPWAATANLCRAVSALALAAGACLAFGTESRADVHLEAIKAAISRHSNGNVQVDAVAATPVPGIFEVTN
    GREVFYADSTGRYAFVDGRLVDIAEKRDLTQARLEQLAAIPFDELPIDLAIKTVRGNGARKLAVFEDPA
    CPVCRSMQDTL
    AALDNVTIYTFAYPVVSPESIPAAVSAWCEPGDQRDRQWQTYMDGAPPPQAIAPQCEPAMQQVGRIVEFGRTREIRSTPT
    LVLGDGRRIVGAMPREELDAALTRAAAR

    >gi|56475680|ref|YP_157269.1| hypothetical protein ebA485 [Aromatoleum aromaticum EbN1]
    MSERLDYTKTSPGGVKAFGSVYGYVMQSGLDDVLVDLVYLRVSQINGCAYCLDMHTRDLVKKGVKVEKLALVQVWQEAGE
    LFSDRERAAFAWAETVTRVAQTGVPDAELEAVSRIFNEKELADLTMAIGLMNAYNRLAISFRRTPEAVLAARS

    >gi|56475899|ref|YP_157488.1| putative peptide methionine sulfoxide reductase msrA [Aromatoleum aromaticum EbN1]
    MTTQDGGFVSRLSGRLASLLGLALIVAAAGAGHAVPATSPATAIFAGGCFWCMEPPFDRLDGVASTTSGYIGGHVPNPAY
    EAVSSGRTGHAEAVRIEYDPEKISYEQLLDVFWRNIDPTDPGGQFCDRGSQYRAQIFYQNDGQRAAAERSRAALVANKPF
    AQPVITEIVPATKFYPAEEYHQDYYLKNPLRYKFYRHRCGRDERLEFLWGVDDGEKK

    >gi|56475900|ref|YP_157489.1| hypothetical protein ebA875 [Aromatoleum aromaticum EbN1]
    MMKRRLFLAALFGSAAAPLVRSVEQSTEALPLKIEKIHRSDEEWRKLLTPEQFRVLRDDGTESAGSSPLNDEKRKGEYVC
    AGCELPLFTSDMKYDSGTGWPSFFTTIPGHVETKLDFRMILPRTEYHCARCGGHQGHVFDDGPPPSGKRW
    CNNGVALKFV
    PAAG

    >gi|56475933|ref|YP_157522.1| iron-sulfur cluster insertion protein ErpA [Aromatoleum aromaticum EbN1]
    MNTVVDTPELMVFTDSAAMKVKELIEEEGNPELKLRVFVSGGGCSGFQYGFTFDEEVNEDDTAFEKNGVTLLVDPMSYQY
    LVGAEIDYSEGLEGSQFVIRNPNATSTCGCGSSFSA

    >gi|56475937|ref|YP_157526.1| hypothetical protein ebB31 [Aromatoleum aromaticum EbN1]
    MECTIKWVDGMTFLAETGTGHVVAMDGAPEAGGRNLAPRPMEMMLAGAGGCTAFDIVLILKRGRQEVRGCEVKLSSERAE
    ADPKVFTRITFHYTVRGKGLKAEAVERAIHLSAEKYCSASIMLGKTAELVHEWDIVECE

    >gi|56475985|ref|YP_157574.1| adenylyltransferase [Aromatoleum aromaticum EbN1]
    MNDDQLLRYSRHILLPEIGVEGQEAILASRVLVIGAGGLGSPAAMYLAAAGVGTVVLCDGDTVDLTNLQRQILHTAEGVG
    RLKVESGRDTLLRLNPQARIEPLAVRLDGAALDEQVAAADLVLDCSDNFATRHAINRACVRFRKPLVSGAAIRFDGQVSV
    FDLRQSDSPCYHCLFPEGQDVDEVR
    CAVMGVFAPLTGIIGATQAAEALKLLIGCGTSLDGRLLLLDGLAMEWRSVLLGRD
    PACEVCAGRDD

    >gi|56475991|ref|YP_157580.1| glutaredoxin protein [Aromatoleum aromaticum EbN1]
    MAKIRMYATNVCPYCVRAEQLLKRKGVTDIEKIRVDQDPSLRDEMIRLTGRRTVPQIFIGDLHVGGCDDLFDLDHAGKLD
    SLLAAP

    >gi|56476010|ref|YP_157599.1| hypothetical protein ebA1095 [Aromatoleum aromaticum EbN1]
    MVATTTPLCNFGWPAPDFDLPGVDGKRHTPASARGPNGLLVMFICNHCPYVKAVIDKIIRDARELAEHGIGSIAIMANDP
    ADYPEDSWDNMVRIARDLDFPFPYVLDATQAVAKAYGAVCTPDFFGFNSRLELQYRGRLDASGRGPTPAGARRELFDAML
    QVARSGEGPREQSPSIGCSIKWREA

    >gi|56476054|ref|YP_157643.1| glutaredoxin-related protein [Aromatoleum aromaticum EbN1]
    MDTQEVIREQVTTNPVVLYMKGTPQFPQCGFSSTAVQILKNSGVPKFFSVNVLENDEIRNGIKQFANWPTIPQLYVNGEF
    VGGCDIMREMYENGELQEVLKSAGATQQG

    >gi|56476244|ref|YP_157833.1| thioredoxin [Aromatoleum aromaticum EbN1]
    MKGIAGRHLIIVAVAVFAGVAGFLVSRGTSDPVPAAQVDPAAGNAILALTLPDSSGELQALQQWRGRVLVVNFWATWCPP
    CLTEIPDFAAVSRGFADSPVQFVGLGIDKAESVRKFREEHDVPYPLLIGTPQTLELTRALGNAVQALPYTIIFDRAGKIA
    HIKLGTLNRSELEGKIRALLDQ

    >gi|56476534|ref|YP_158123.1| thioredoxin reductase [Aromatoleum aromaticum EbN1]
    MADIYDALVIGGGPGGLAGALYLARFRRRVRVVDDGCSRATRIPRSHNMPGYPRGVPGNKLVAAIRKQAEAYGAELSVGR
    VETLERVAPGFAAVLADGTRLLARTVLLATGVSDVEPDLPHLVEAVRTGALRY
    CPVCDGYEIIDKAVGVLAASEAGIREA
    LYLRNFTARLHVFRTSHDFRIEEHSDRLAEAGIRWAPEPVDSLRLWDAEVRVRHGAAETCCDSVYSALGTRVHAELSMGA
    DTDEAGYLLTDRHRKTSIDGLYAAGDVAQGLNQISVAAGDAAIAAAAIHLALAPAWRK

    >gi|56476779|ref|YP_158368.1| hypothetical protein ebA2405 [Aromatoleum aromaticum EbN1]
    MKLPGCARSRAVILLTLPAAAMALGTAAWMFLRPDITAQADARPLHPAEAAPSTPSPPLTPAGPPWRYGPPEARFTVVEY
    ADLE
    CAFCRTYFPVLKRWIDEHPEVSWQWHHLPLAMHEPAATAEARLVECVGESGGHAAFWQAVDWVYAHTRGDGLGLPE
    GTHYPDLTPAAQQCLASDRPDAVVRAHAAEAARHGVAATPALQLRDRESGKVILLHGPVDGDALLSALDLLASDEESTAE
    SSRPPDMPAASVGDMPR

    >gi|56476885|ref|YP_158474.1| electron transport subunit of NADH:ferredoxin oxidoreductase [Aromatoleum aromaticum EbN1]
    MHEYALLLLSTALVNNVVLVKFLGLCPAMGVSKSMDAALGMGLATTFVITLAAAASWMLEHWLLAPFDLGFLRILSFILV
    IAAAVQFTEMAIRKMSPALYQSLGIYLPLITTN
    CAVLGVALLNVQQGYGFFKSVLFGFGSALGFTLVLLIFAGLRERLAL
    ASVPAAFAGAPAAFITISLLSLAFMGLSGLVAT

    >gi|56476890|ref|YP_158479.1| SoxR-reducing system protein RsxE [Aromatoleum aromaticum EbN1]
    MNIGGIVRDGLWENNVVFSQMLALCPTMAVTTTGTNALAMGLATTAVLVVSNVLVSMIRTTVSSQVRIPVFVVLIATLVT
    IVDMAMNAWAHELHKILGLFIALIVVN
    CAILGRAEAFASKNGVVASAFDGLATGLGFTLALTVIGLIRELLGSGTLFAQA
    SLLLGPGFAFLEMRLPEYDGALLMILPPGGFAVLGLLLAAKRVFETRRETPRQAVPQVPASAPAA

    >gi|56477039|ref|YP_158628.1| hypothetical protein ebA2851 [Aromatoleum aromaticum EbN1]
    MEIKVNFLDKLRLEAKFDDFTVIADQPVRYKGDGSAPGPFDYFLASSALCAAYFVKLYCDTRNIPTENIRLSQNNIVDPE
    NRYQQIFKIQVELPADISDKDRQGILRSIDRCTVKKVVQTGPEFVIEEVENLDADAQALLMLNPASEASTYIAGKDLPLE
    QTIANMSGVLAGLGMKIEIASWRNLVPNVWSLHIRDAHSPMCFTNGKGATKESALASALGEFIERANCNHFYNDQFWGED
    IANAAFVHYPHERWFKPGRKDALPTGILDEYCLEIYNADGELRGSHLYDTNSGNIQRGICALPYVRQSDGEVVYFPTNLI
    DNLFLSNGMSAGNTLAEAQVQCLSEIFERAVKREILEGEIALPDVPHEVLAKYPGIQAGIQALEDQGFPVLVKDASLGGE
    FPVMCVTLMNPRTGGVFASFGAHPSLEVALERSLTELLQGRSFEGLNDLPRPTFESNAVTEPNNFVEHFIDSSGVVSWRF
    FSAKADFDFVEWDFSGQGENSNADEAATLFGILEDMGKEAYMAVYDQLGTTACRILVPGYSEIYPVEDLIWDNTNKALAF
    RDDILNLHRLDDASLQALLERLEDSELDDYIDIISLIGIEFDENTAWGQLTILELKLLINLALRQFEAAHELVKTFLQYN
    ENTVERGLFYQALNGVLEVLLDDDLELDDYVVNFRRMFGNPRMDAVMGSVDGSVRFFGLTPTSTKLEGLDRHQRLIDSYE
    KLHRARANVAVLSS

    >gi|56477081|ref|YP_158670.1| thiol peroxidase [Aromatoleum aromaticum EbN1]
    MSKVTLGGNPIEVAGNFPQKGNTAPLLSLVGADLAEVTLAKYAGKRKVLNIVPSLDTPTCATSTRKFNAEAGKLDNTVVL
    VISGDLPFAAKRFCVAEGLDNVVTLSTLRGREFLNDYGVEIASGPLKGLAARAVVVLDENDRVLHSQLVGEIKDEPDYAG
    ALAALK

    >gi|56477401|ref|YP_158990.1| hypothetical protein ebA3480 [Aromatoleum aromaticum EbN1]
    MSDIRRALRRRTLASLAGVAALAAAPKTLVAATRGAGAPDRFEAVDAPNAVPAALRAALEPLRNRAVLVNFWATWCEPCR
    AEMPALADLDAIETDLALLTVAVADRDGDVRRFFAAHRIDPLVVADPEQVIARAWAVRFLPTTFLLDASHRPRHRIRGEL
    DWNDPAVRERVMTLVAPPNDPTPH

    >gi|56477404|ref|YP_158993.1| hypothetical protein ebA3488 [Aromatoleum aromaticum EbN1]
    MILDIDFVSDFVCPWCFIGNECLRQAIDEVRHSVADLEEIRVNRLPFFLDPDTPVAGVPYRPFLDAKFGGRRKADEVLAR
    IVAAGAPDGVTFAFDRIATRPNTLNAHRLTYRAQSLGHTQEHVNALGHALFAAHFQDGRDLGDNATLADIAAAAGDDRET
    VFAYLESDDDAAAVRRMAEQIQKQGITAVPFFIFNRKLAVSGAQSQTTLGAAILQSLHVS

    >gi|56477422|ref|YP_159011.1| cytochrome c biogenesis protein [Aromatoleum aromaticum EbN1]
    MKAKFLVPLALFLVLAGFLGYGLQLNPREVPSPLVDKPAPQFRLATLAAPDAALGAADMRGEVWLLNVWASWCVSCREEH
    PVLMELARDKVVPLVGLNYKDTRPEAIAWLEAHGDPYTASVVDADGRVGIDYGVYGVPETFLIDRQGVIRYKHIGPVTRE
    AVRDVLLPKIAELSRAS

    >gi|56477456|ref|YP_159045.1| thiol-disulfide interchange protein, potentially involved in divalent cation resistance [Aromatoleum aromaticum EbN1]
    MIPVQAPLPATPQNPTNSDTFSEPMRRLLLLLAALASLLALLPPTFAQGSPIEPEKAFRFAARALDPATVEITFDIADDY
    YLYGDKFKFTADPPTVQLGIPERAPGKIRHDEFFGDVETYRDEIRILLPVIAAEGVTAFRLTATSQGCWDGGICYPPTQQ
    STDIDLTATPVAAGGSFIDRFLSPGSTAGAGTGTAPSGDESGRIAGLLRDASVPLILLSFFGFGLLLAFTPCTFPMIPII
    SGVIVGHGHHISRGRAFALSLVYVLGMAAAYAVAGVAAGISGTLLSAALQNAWVLGAFALVFVLLALSMFGFYELQLPSA
    LQSRLSSTANHQKGGSLGGVAVMGVLSALIVGPCVAAPLAGALLYIAQTGNATLGGVALFVMALGMGAPLIAVGVAARSV
    LPKVGPWMEGVRKAFGVMLLGVAVWLLTPVVPALVTMLAWAALLLFSGIFLHAIDPLPAHAKGWARFWKGTGVVMLIAGA
    AMFVGALAGSRDPLQPLAVLRAEASASVATAPRFEKVASVAELDARLASADRPVMLDFYADW
    CVSCKEMERFTFSDGAVQ
    ARMERMLLLKADVTANSDDDKALLKRFTLFGPPGTIFFDRDGKERDGLRVVGFMAAEPFGELLDRALR

    >gi|56477481|ref|YP_159070.1| thiol:disulfide interchange protein dsbA precursor [Aromatoleum aromaticum EbN1]
    MNRRLALKQLAALGALSTLGASASVFAQREAFQTLGTKVPTEVAGKIEVIEFFSYGCPHCHDFEPLLNGWAKKLQGDVNF
    IKVPITFNRPEWTALARLYYTLEAMGQAEEKGAAVFAAIHDERKPLHREDVLMQWVAGSGLDSKQFSDTYKSFGVQSKVQ
    RSNQIAAAYKVSGVPMMAVDGRYTVSASSAGGFEQMLKEVDQLIARSRSEQKKS

    >gi|56477635|ref|YP_159224.1| putative disulfide bond formation protein B 1 (disulfide oxidoreductase 1) [Aromatoleum aromaticum EbN1]
    MQSFAFSTRALFLGLFAVCAGLLGFGLYLQHAVGLEPCPMCIMQRYAFVAIALTALVAGLHGPGRRGTRAYAAVILLLAL
    AGGGVALRQTWMQLYPPEFAE
    CGPDLEFMLGSFPLADALPMIFQGAGDCSKVDWAFLGLSIANWSLVCLTLVAVFAIMMI
    ARKRGG

    >gi|56477757|ref|YP_159346.1| putative thiol:disulphide interchange protein (periplasmic) [Aromatoleum aromaticum EbN1]
    MVERALRPVLVTAFVGMTSLGLAHADEGSVRKAVEGFVGSPVVESVARIPYGELYEVVLKSGEIVYTDEKMSFLIDGRVI
    DTSTRRDITQARMAQLSAIDVGTLPLDQAIKQVRGNGKRVIVSFEDPN
    CAYCKRLGKELAQLKDVTVYTFLYPILSPDST
    EKSRNIWCADDRAKAWSDWILNAKVPASASCDSSVVERNVTLGQKLKINGTPTMFLADGRRLGGYLPAAELEQALLEAGK
    K

    >gi|56477771|ref|YP_159360.1| rhodanese-like protein [Aromatoleum aromaticum EbN1]
    MGKLTDLLGLARRRAQELNLPYAGALTPAEAYEVWQLAPGARLVDVRTRAEWDWVGRVPDAVEIEWLSYPGNQANPHFLA
    QLKREVDPEALVMFM
    CRSGGRSDKAARAASEAGYPECYNVLEGFEGDLDANGRRNRIGGWRHAGLPWRQS

    >gi|56477801|ref|YP_159390.1| putative thioredoxin [Aromatoleum aromaticum EbN1]
    MTETLTIACPHCHVLNRLPGGRLSDDPNCGKCHQALFTSHPVELDAASFDVHAGHGDLPLLVDFWASWCGPCRTMAPAFE
    EAAAKLEPHVRLGKVNTEEAQDLAARYAIRSIPTMVLFRAGREVARQSGAMNTGQILQWAKAQGL

    >gi|56477817|ref|YP_159406.1| peptide methionine sulfoxide reductase MsrA [Aromatoleum aromaticum EbN1]
    MTEQEMPAARETAILAGGCFWCLEAVFKDVEGVEAVTSGYTGGRVDSPSYRQVCEGGTGHAEAVRIVFDPEVIGYRDLLE
    IFFVIHDPTSLNRQGNDVGTQYRSAIFATTDEQLHEALALIEEMGEMRVYPSAIVTKVERAGTFWPAEDVHRDYYARNSD
    QSYCQYVVAPKIAKFRENFASRRKQGG

    >gi|56477908|ref|YP_159497.1| hypothetical protein ebA4360 [Aromatoleum aromaticum EbN1]
    MHATLPFLARTDFPPLKRRAVETLQVNLGYRCNQSCVHCHVNAGPSRKEAMTAATVDAVLAFAAASPDIKTIDLTGGAPE
    LNPQFRRLVAAARARGLHVIDRCNLTVLEEPGCEDLADFLAAHRVEVVASLPCYLEDNVDRQRGKGVFDASLRGLVRLNR
    LGYGAVGSSLVLNLVYNPQGASLPPPQADLEASYRRHLGERFGIFFNQLFTLANMPIQRFGSQLISKGHFNTYMRTLRDA
    HHDENLAHVMCRTLLSVDWQGYLYDCDFNQQLGLPIAGSTDNRLHVTSATAAALAGRPIRVADHCYGCTAGQGSS
    CGGAL
    DEETVAAVRRSG

    >gi|56477920|ref|YP_159509.1| 6-O-methylguanine-methyltransferase [Aromatoleum aromaticum EbN1]
    MNLPPTASSGDPFAAILAVPFGAFGIRVAGNVIHELVFLPPGTRAIPPDCALAERAVIQIHAWLEDPDRPFDLPLATRGT
    LFQRRVWDAIAAIPRGETRQYAHLSKALASAARAVGQACRANPFPLVIP
    CHRVVSATGIGGFAGASGGYLIDAKHWLLAF
    EANQ

    >gi|56477933|ref|YP_159522.1| peroxiredoxin [Aromatoleum aromaticum EbN1]
    MAVLVGKQAPDFAAAAVLGDNQIQDITFSQFTKGKYAVLFFYPLDFTFVCPSELIAFDHRLDEFKKRGVEVLGVSIDSQF
    THLAWKNTPVNSGGIGQVQYPMVADTKHEICRAYDVESEGGVAFRGSFLIDKAGVVRHQVVNDLPLGRNIDEMLRMVDAL
    QFTEEHGEVCPAGWNKGKAGMKADPSGVADYLAHHAESL

    >gi|56477962|ref|YP_159551.1| thiosulfate sulfurtransferase [Aromatoleum aromaticum EbN1]
    MNASYSTLIAARELAEHLDDPDWCIVDCRHDLADPGFGRAAYERGHLRGAHFLHLDEDLSGRMTGTNGRHPLPEPADFAA
    RLGRLGIGNDTQVIAYDDAGGMFAARLWWMMRWLGHRRVAVLDGGLVAWCAAAQALTTETPSVHPTTYSLSLQPTVVDIA
    FVLDHLYTGDIMLIDARSPDRFRGENETLDPVGGHIPGAKNRFFRDNLVGGGCFKQASVLREEFGTLLKGRDARRVVHQ
    C
    GSGVTACHNLLAMESAGLSGSRLYAGSWSEWCADPRRPIATGPEE

    >gi|56478024|ref|YP_159613.1| carboxymuconolactone decarboxylase [Aromatoleum aromaticum EbN1]
    MRRPWSVSERSGHGTHASRTGGRSDGNGWRVSTMDQSLYPQWNIEAARKRKELAPGPLAAFKAFSDAVFADGALPKKTKQ
    LIAVAVAHVTQCPY
    CIHGHTSEALKSGATEEEIMEAIWVAAEMRAGAAYAHSMLAIETMKHSQD

    >gi|56478118|ref|YP_159707.1| thioredoxin [Aromatoleum aromaticum EbN1]
    MSEHIHYVTDGNFEAEVLQSQTPVLVDYWAEWCGPCKMIAPILDDVAKEYAGKLKVAKLNIDENQETPAKFGVRGIPTLM
    LFKGGNVEATKVGALSKSQLTAFIDSNL

    >gi|56478211|ref|YP_159800.1| SoxR-reducing system protein RsxE [Aromatoleum aromaticum EbN1]
    MNLQTFRENAWNGLWKQNTGLVQLLGLCPILAVSTSVVNAVSLGLATVVVMAVSNFAVASLRNFIPYEIRIPVFILIIAA
    LTTVVDLAFNAYLHDLYLVLGIFIPLIVTN
    CIVLARVEAYAAKNDPVASTVDGIMMGLGLVWLLGVLGGIRELVGSGTLF
    SGIEMVIPGLSPLSVFGDDYPGFLIGVLPPGAFFALGCLIALSNRIRMRAAAGKPARPASDSEGPAPASAAP

    >gi|56478216|ref|YP_159805.1| NADH:ferredoxin oxidoreductase [Aromatoleum aromaticum EbN1]
    MSSYIFVVIGAVLVNNVVFVRILGLCPFMGVSKKLETAIGMGAATTFVLTLGSGTSYLIDHYLLQPYDLAYLRTLSFIVV
    IAAIVQLTELVIQKTSPLLHQVLGIYLPLITTN
    CAVLGVPLLSVALDYNLLESLLFGFGSSIGFTLALILFAGIRERLDG
    ADVPAPFKGTAIAMITAGFMSLAFMGFAGLDRFQ

    >gi|56478251|ref|YP_159840.1| putative peroxiredoxin [Aromatoleum aromaticum EbN1]
    MTASATSSTPEFSLPATGGTTVALPALRGSKVVLYFYPKDSTPGCTNETADFRDHHAAFRAAGCEVFGISRDSLKSHENF
    KAKLALPFELISDTDEVACNAFGVIKMKNMYGKAVRGIERSTFVLDAEGAIRHEWRGVKVPGHVQEVLDFVTTL

    >gi|56478284|ref|YP_159873.1| hypothetical protein ebA5007 [Aromatoleum aromaticum EbN1]
    MKHVILGNGPAGVIAAETLRRAAPTDDILLFGSEDAPPYSRMAIPYLLEGNIDESGTWLRKSPGHFDRLRIHEMRGRAVS
    LDSERRRILFDDGHFESWDRLLIATGSHPVRPPIPGIDLPEVQT
    CWTLEDARAIARFATPGARVLQLGAGFIGCIIMEAL
    AARGVELTVVEMGDRMVPRMMTPTAGGMIRKWVEDQGVRVVTNAGVSRIDCRASNDAPLDVTLSTGEVVVADLVIVAAGV
    APNIAFLEATPVHVAKGVLVDDRLQTSVPGIFAAGDVAEAPDLFTGAHLVAAIQPNAADQARVAALNMAGHEARLKGVLA
    INVLDTLGLISSSFGQWWGEERERGGAGVEHVDEAAYRYLSLQFKDDVLIGATSIGLTEHVGALRGLIHGRVRLGEWKER
    LLHSPLQFVDAYIARSQQPMALVR

    >gi|56478348|ref|YP_159937.1| cation transport P-type ATPase [Aromatoleum aromaticum EbN1]
    MPEQDCYHCGLPVPPDTHHYVTIDGASRRMCCVGCEAVAESIVANGLTDYYRHRDAMPEPQKEALPAELQELGLFDHPDF
    QKTFVQPIGEHEREAALILEGIT
    CAACVWLNEQHVARQPGVSLVEVNYATRRARVRWDERRVKLSEILSAIQAIGYRAYP
    YDAERSEQIGKRERRSMLWRVFVAGFGMMQVMMYAFPAYIAPEGDLAPDIAQLMRWASLLLTLPVVLYSAAPFFQRALRD
    LKLRRLGMDVPVALGVGSAFAASLWATLVGGGEVYFDSVTMFVFFLLCGRYLEMVARQKAVRGVEELGKVLPAFAELLPA
    WPAPDGERVPVSQLVPGNFVRVRPGEVMPADGVVVDGRSEANEALLTGESLPVPKFAGSPVTGGSINISSPLTVRVEQVG
    DSTRLAAIRRLMERGASEKPRLAQQSDRFAVVFIVALLVLAFATGLAWYFIEPGRALWVFVSVLVVACPCALSLATPTAL
    TVATDALARMGVLVTRGHAIETLGRVNHFVFDKTGTLTRGRMSLEEVLPLGELGEAELRVLAAALERDSEHPVGEALRRA
    GGDDVLPAVDEVVAQTGQGIAGRIDGVRHAIGRTAYVAAQLDLPEPARCGEFEGRGGSMIALGRTGEWLGLFRLADVPRE
    EAAQLTTKLLAEKVRMTVLSGDSPGAVDAVAQGLGIDDAHGALTPQGKQQFLAKLQRAPGAVVAMVGDGVNDAPVLAQAH
    VSVAMGGGTELARNEADIVLLSENLAGLGRGLDLSRRTLRIIRQNLWWSFAYNFTSVPLAMAGLVTPWMAGIGMAGSSLL
    VVLNALRLQRQPRSGVR

    >gi|56478367|ref|YP_159956.1| copper-transporting ATPase [Aromatoleum aromaticum EbN1]
    MNNPVMDPRHAAIELPVSGMTCAACAARIEKVLNRLPGVSANVNLAAEKARVNFSAAEAGPAEVVAAIRKAGFDVPAATL
    ELAISGMT
    CAACAARLEKVLNRLPGVEAAVNFATERATVRYQPGLVTTEALKDAVQRAGFAAAETGLADREQVRLRQAAV
    WKAELRHFWIAVLLTLPLAAQMPAMFGGGWAADAHHEFLPRWLQLMLATPVQFWIGARFYRGAWSSVRGGGANMDVLVVL
    GTSMAWSYSAIVTLFGRHDLHVYYEASAMIITLILLGKLLEARAKARTTAALDALLRLQPRVAHVERGGELVAVPVDSLK
    PADLFVVRPGDAVPVDGEVVSGASALNEAMLTGESMPIDKRAGDKVFAATLNGEGVLRCRATGVGAHTLLAGIIRMVEQA
    QGSKAPVQRLADRIAAVFVPVVVGIAVVTFVSWWWLGGDFAQALISAVAVLVIACPCALGLATPTAIMVGTGQGARAGML
    VKNAEALELAEKIRVLVVDKTGTLTEGTPAVSDVVPADGWDRAGLLGIAAALEQASAHPIATAVVAEARAMGAMIASAGD
    SLAEPGKGLSGRVDGRDVVLGTPAFLAERGIDMAGVSWESLAAAGKTMVAVAVDGRCAGVIAVADRVRQDSASAVARLKA
    RGLRVVMLTGDHAATAAAIARETGVDEWQAGVMPADKAAAVQTFAQGGERVGMAGDGINDAPALAAADVSFAIGVGADVA
    VEAADITLVRNSLHGVADAIDLSRATLSKIRQNLFFAFIYNILGIPLAAFGLLNPVIAGAAMAMSSVSVVTNSLLLKRWR
    PGR

    >gi|56478368|ref|YP_159957.1| copper chaperone [Aromatoleum aromaticum EbN1]
    MVETVIRVEGMSCGGCVNSVTAALKSLPGVTDANVSLDSAQARVQYDPATVSEQQLREAVEEAGFDAPA

    >gi|56478552|ref|YP_160141.1| hypothetical protein ebA5471 [Aromatoleum aromaticum EbN1]
    MRELVVMSREWCHLCHDLLDELRPLAAELGWTLRVLDVDADPELEARWNELVPVVLGGNTELCRYRLDAAAVRAYCRRFP
    LESAP

    >gi|56478745|ref|YP_160334.1| peptide methionine sulfoxide reductase [Aromatoleum aromaticum EbN1]
    MSRKVDKPEAEWRAQLTPAQFQVTREKGTERAFTGEYWDCWDKGEYHCIGCGAPLFSSEHKFDAGCGWPSFWTAAAPENV
    ETAEDRSHFMQRTEVLCHECGAHLGHVFEDGPQPTGLRY
    CINSASIRLEPEASANDGQPRGPQSTG

    >gi|56478895|ref|YP_160484.1| thioredoxin-like protein [Aromatoleum aromaticum EbN1]
    MQAHPRRLRDGRGRRPSRAEYASLSRYALTRDDRLTAFPMDDQPLPELLVACLCADWCGTCRDYRTGFEALARVWPHAGF
    HWVDIEDDADWLGDLDVENFPTLLIQRGELVLFFGTLLPQHVFLQRTLETFAAFDDEEARTYAFANEERRAWQRDCNFRA
    ALQRRSAGHDA

    >gi|56479092|ref|YP_160681.1| putative glutathione peroxidase protein [Aromatoleum aromaticum EbN1]
    MSVPANVFDFETRRLNGAPMPLAEFRGKVLLLVNTASECGFTPQYEALQELHDRFAPRGFSVIGFPCNQFGGQEPGGAEE
    IAAFCAKNYGVSFPLSEKIDVNGDNAHPLYRHLTSVAPGILGTEAIKWNFTKFLVDRDGQVVARFAPATKPESIARDIEA
    LL

    >gi|56479097|ref|YP_160686.1| IscA protein involved in Fe-S cluster synthesis [Aromatoleum aromaticum EbN1]
    MSVTLSTNAAKHVSEFMAKRGKGVGIRLGVKTSGCSGMAYRLEFVDDMHDEDLIFESHGVKVIVDPQSLAYLDGTELDFV
    REGLNEGFKFNNPNVKDACGCGESFNV

    >gi|56479121|ref|YP_160710.1| hypothetical protein ebA6442 [Aromatoleum aromaticum EbN1]
    MLSIKVLGPGCANCRKLEEVAREAVAATGVEAEIAKVTDMQQIIAYDVLKTPGLVINDKLVSSGRIPTPASVAEWIRAAA


    >gi|56479136|ref|YP_160725.1| alkyl hydroperoxide reductase [Aromatoleum aromaticum EbN1]
    MLQIGEMAPAFSLPDAEMEVFDLAAERGRHHVVLYFYPRDNTPGCTRQAADFSDHEEDFARHDCIVVGVSPDDCLTHAEF
    RDQHGLSVRLLSDVEREVCRLYHVWQPREVDGVKKMGVVRTTFVIDKEGVIRHMLHDVSPRGHVAGVFELVRKLQTENAH
    GNRQEQRGNA

    >gi|56479214|ref|YP_160803.1| periplasmic thiol:disulfide interchange protein [Aromatoleum aromaticum EbN1]
    MATTEAVRGRLAAIALITAFAGAFPPALAATSDESRLLTALQKAHPGTRFTEVTRSPVAGLFEVWMDGNVAYVPASAPRY
    FLFGRLFDTETLRDLTGPKLAQAARTSSPADSADVQTPIPPVAFDQLPLGDAIKTVRGKGERRLAVFSDPN
    CPYCQQLEP
    ELASLDNVTVYTFLVPFQGETKPIAVWCAADREQAWERLMLQGDETLLSPGATCDHPIARNLELARRLGVQGTPTLVWAD
    GTRTEGFVGRTVLKARLAQAGIPERQP

    >gi|56479237|ref|YP_160826.1| hypothetical protein ebA6654 [Aromatoleum aromaticum EbN1]
    MKNLVLDNRFVHELPGDPNPSPDVRQVHGACYSRVMPTPVSAPHLIAWSPEVAALLGFDESDVRSPEFAAVFAGNALMPG
    MEPYAACYGGHQFGNWAGQLGDGRAITLGEAVTTRGDGHTGRWELQLKGAGPTPYSRHADGRAVLRSSIREFLCSEAMHH
    LGVPTTRALCLVGTGEKVVRDMFYDGRPKAEPGAVVCRVAPSFIRFGNFEIFTSRGDEALLTRLVDFTIARDFPELGGEP
    ATRRAEWFCKVCERTARMIAQWMRVGFVHGVMNTDNMSILGLTIDYGPYGWIDNFDPGWTPNTTDAGGKRYRFGNQPHIA
    HWNLLQLANALYPVFGAAEPLHEGLDLYARVFDEENRRMLAAKLGFEAFGDEDATLVETLHALLTRAEVDMTIFFRGLAS
    LDLEAPSIDPLRDAFYSAEKAAVAEPEMNSWLAAYTKRTKQERTPGDQRRVRMNAVNPRFVLRNYLAQEAIDAAEQGEYA
    LVSELLDVMRHPYDEQPGRERFAARRPDWARNRAG
    CSMLSCSS

    >gi|56479256|ref|YP_160845.1| dihydrolipoamide dehydrogenase [Aromatoleum aromaticum EbN1]
    MADKQFDVLVIGGGPGGYVAAIRAAQLGFKTACAESNPYADPKGEPRLGGTCLNVGCIPSKALLHTSHLFEEAEHAFPTQ
    GIRLEGKVSIDVPVMIGRKNKVVDQLTSGIKGLFKKNKVTFLAGHGSFEGNGPAGYVVRVGAETVEARHVIIATGSKPRH
    LPGIPVDNRIV
    CDNVGALDFDSVPKKLGVIGAGVIGLEMGSVWRRLGAEVTVLEALPDFMPFADMDVAKEALKVFTKQGL
    DIRTGVTIGETKVGADGVSLAYTGKDGKEARLECERLIVSVGRVPNTEGLNASTVGLDVSDRGQIVVDGHCRTNLPNVYA
    VGDVVRGPMLAHKAMEEAVMVAEIIAGQAGHANLDTVPGVIYTSPEIAWVGKSEQQLKAEGVAYRAGKIPFMANGRALGS
    GDPTGFVKMLADADTDRILGVHIIGANASELISEAVVAMEFGGAAEDLARICHAHPTLSEVVHEAALAVDKRPLHF

    >gi|56479274|ref|YP_160863.1| hypothetical protein ebA6707 [Aromatoleum aromaticum EbN1]
    MKARRVYAGWPKPAHFDRNLVVIGAGAAGLVSSYIAAAVKAKVTLVEKHRMGGDCLNTGCMPSKALIRSAKLLSHMRRSN
    EFGIRSARAEFDFADVMERVHAIIKTVEPHDSVERYTSLGVEVIEGRAKIVSPWEVEIARNDGRHETLTTRSIIIAAGAR
    PTVPPIPGIEDVGYYTSDTIWTLHALPRRLLVLGGGPIGSELAQTFARFGAAVTLVVKGRRIMPREDAEVSEMVMARFRA
    EGIDLRTGHDTRRFVVENGEKILIAEHQGQEVHVPFDVLLVAVGRSAQLKGYGLEELGVPTGRTIDVNEYLQTSFPNIYA
    AGDVAGPYQFTHTAAHQAWYASVNALFAPFRKFRADYSAVPWATFVDPEVARVGLNEQEARERDIPFELTRFDIADLDRA
    IADGEAHGFVKVLTVPGKDRILGVTIVGEHAGDLIAEYVMAMRHGLGLNKILGTIHIYPTLAEANKYAAGEWKRAHAPQK
    LLEWVGRFHAWRRGSGGRPTAAARPATPSQR

    >gi|56479302|ref|YP_160891.1| hypothetical protein ebA6753 [Aromatoleum aromaticum EbN1]
    MSERLDYTKTSPGGVKAFGSVYGYVMQSGLDDVLVDLVYLRVSQINGCAYCLDMHTRDLVKKGVKVEKLALVQVWQEAGE
    LFSDRERAAFAWAETVTRVAQTGVPDAELEAVSRIFNEKELADLTMAIGLMNAYNRLAISFRRTPEAVLAARS

    >gi|56479333|ref|YP_160922.1| selenophosphate synthetase [Aromatoleum aromaticum EbN1]
    MDQIKLTQFSHGGGCGCKIAPAVLSKLLAHAPAGLVPPDLLVGTETADDAAVYRLNDRQAIVATTDFFTPIVDDPYDFGR
    IAATNALSDVYAMGGRPIMALAIVGMPIDKLPPEVIGRILEGGASVCRDAGIPIAGGHSIDVLEPIYGLVGLGVVDPAQV
    KTNAGAKAGDVLILTKPLGIGILSAGLKKGLLEKADYAAMLHWTTLLNRVGMHLAGMAGVHAVTDVTGFGLAGHLLEICR
    GSNLTASVSFGEVPTIDAALRLVRDGIATGASTRNWASYGESIRFAPEAPEWQRKLVTDPQTSGGLLIACAPDAVDEVLA
    AIRAEQGSDGRVIGRMEVGEPLLRIV

    >gi|56479399|ref|YP_160988.1| putative NADH dehydrogenase [Aromatoleum aromaticum EbN1]
    MQTSTVGTAALAYFLGTPGQDFLPEDDERRDKPTSNPAWPGACTDTTSHRIVIVGGGAGGLELAARLGDGVGRRGEAEVV
    LIDPMPAHLWKPLLHEIAAGTRSPHEQALDYLQQARQHHFRFHPGRIEGLVRHRREIWLAPLIDEEGVEMAARRQLRYDT
    LVIAIGATDDDFNTPGVRRHAISLNSAADAEHFRSRLLSL
    CAGAGQDAARPVQLVIVGGGTTGVEFADELTGAVEEIASC
    GYLLRQVGEPVKIRMIEASDRLLAPLPAEAAERIHRELVRRGIDVRLNRRVAEVRHDSVLLGNGEILAADLVVWTAGIRG
    PEVLASLGALDTNERQQLLVRTTLQTFRDDNIFAIGDCANCVSSEGDTLAPPLARAAQQQAKLLAHSLERRLAGKSLIPF
    RYREHGALSPGRNEGPAGDTSRDRNGVGGLFARLSYWMLYRRHLAVLLGGMRTLLMTVGEWLPRRARPRLKLH

    >gi|56479434|ref|YP_161023.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Aromatoleum aromaticum EbN1]
    MTTKHARLLILGSGPAGYTAAVYAARANLDPVLITGLAQGGQLMTTTDVDNWPADADGVMGPDLMARFQKHAERFNTEMV
    FDHIHTVKLGEKPFRLVGDAGEYTCDALIISTGATAKYLGLPSEEKFSGRGVSA
    CATCDGFFYKNQDVAVIGGGNTAVEE
    ALYLANIAKKVTVVHRREKFRAEKILIDKMMEKVAAGKIELALNSTLDEVLGDNTGVTGMRVRDANTGATRDVALQGVFI
    AIGHKPNTDIFEGQLEMENGYIITKGGREGDATATSVAGVFAAGDVQDHIYRQAVTSAGTGCMAALDAERYLDTLAG

    >gi|56479516|ref|YP_161105.1| methylated DNA-protein cysteine methyltransferase [Aromatoleum aromaticum EbN1]
    MTTKHEMLAAVTSAEIQFATGECSLGAILVAASGPGVCAILIGDDPERLARDLQDRFPHAALISGDADFERTVATVVRFV
    ESPALRLDLPFDIRGTAFQQRVWQVLREIPPGQTASYAEIARRIGAPKAARAVAGACAANLLAVAIP
    CHRAVRNDGQLSG
    YRWGIERKRALLDREAGR

    >gi|58616272|ref|YP_195401.1| protein-disulfide isomerase [Azoarcus sp. EbN1]
    MLSKFARTLSVTALAAACVVGSAFAATTEEAELKAYMEKTYPNTPIAEIKRSPVPGIFQVTMGRTVAFADKSGRYFIFGP
    MFDMKEQVDLTAEARNNLSRAKWDSLPLDLAFKVVKGDGSRKFAVFTDPD
    CPFCKRFEQELMKLDNYTMHVFLSPIASLH
    PNAKEKAESVWCSKDRAQAWTAMMVEGVTPPVATCDNPLEKIERLSREIGVSGTPSLVRDDGTFKAGYMPVAAMDAWLND
    SSAKR

    >gi|56477834|ref|YP_159423.1| SCO1/SenC family protein [Aromatoleum aromaticum EbN1]
    MLRSLILATALALAGCTDSSAPKPSFHATDITGAEYGSTFALTDHHGTPRTLADFRGKVVTMFFGYTQCPDVCPTTLSTM
    SEVMRLLGPDAERVQVLFVTVDPERDTQALLANYVPQFDARFIGLYGDAAQTQAVAKDFRIFYQKSGDTEGANYTVDHVA
    GTYIFDPTGRLRLYVRHGESAENIAADIRALLAAK