Mycoplasma pulmonis

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|15828492|ref|NP_325852.1| dihydrolipoamide dehydrogenase [Mycoplasma pulmonis UAB CTIP]
    MEKFDFVIIGSGPGGYSLALILSKLGKKVAIAERKNFGGSCINEGCVPTKGLVKVARTYELIKNSSKFGIKVNDFSFDWK
    QIIKRKNEIKDTLNNSIEKNLELNNVKIFKAEAKVLKDKSIEVNNTKIYAEKIIIATGSRARKISFDGSDKALEKQVLVD
    SNYLLDMQEVPKSIAFIGAGPISLELGYVLSALGSDVTLLEGRDQILANFDHDVREEVLKYLEQKNIKYFTSTKVLKYDQ
    DGLHFSVGEKNKVINPEKIALSVGREANLEAVEDLDLELNPNKTIKVDDKLETSIKGIYALGDVTGKMMLSTIAYKHGDV
    IVNNLINNKEVKLDYKKVPHTIYLSPEISSIGLSEEEAKKTYGENLLAIKIPSERLPRNHADGNLGYGFFKLIINKDTKQ
    VLGASIILENSSLIINEISIAMNNDLTIYDLAKSPHVHPTLAEALYYAIRDLSFQ

    >gi|15828494|ref|NP_325854.1| NADH oxidase (NOXASE) [Mycoplasma pulmonis UAB CTIP]
    MQINAFLLSKKINENLFQERKKMKVVVVGANHAGTSFIRTFKQLNKTDELVVYDRNTNTSFLGCGIALWVGGEFKSPEGL
    FYSSPEKLAKLGAKVHLEKELINVDYKTKTLTFKDLQTNKEFTDTYDKLVFSLGTSPIVPPFKGIDYKNIIVSKLFQHAE
    EIFKKAESKEVKNVVVIGAGYIGVELAEAFIKHGKNTTLVDLQERVIPNYFDEEFTSKMEDSMRKHGLKVQLGEKVQEFQ
    SKDGTNVSAVVTDKGTYEADLVILAIGFRPNAQFLNFDKTVNGALKVSPRQNVLLDGQEVKEIYAIGDSAAMIHNVTNQH
    QHVALATNAVKTGVIAALDMVGQGIDFPGVTGTNAISVFGCHYSSTGMTEKSAKNFGINAVSTEYFEDFDRPEFMNDKSK
    VGFKVTYEKRTLRLLGAQVGSWSDHIHTEVIYAFSLAIQQGLTLPQLALMDVYFLPHFNKPFNFMLTPILKALGINYE

    >gi|15828566|ref|NP_325926.1| methylated-DNA--protein-cysteine methyltransferase (6-O-methylguanine-DNA methyltransferase) (O-6-methylguanine-DNA-alkyltransferase) [Mycoplasma pulmonis UAB CTIP]
    MYFEYSENEVNYLKRKDKKLAKAIEKIGFIKREIKPNLFVAIVHSIIGQQISTKAHKTLWKRFEEKVKNIDAKTLASFDL
    FDFDGIGIANRKLTYILDFAKKVYNKEFDIDALYSMSDNEAIKSLSSLKGIGQWTAEMAMIFSMQRKNILSYKDLAIIRA
    IKMLYGYKDVDKITFEKLEKRYSPFASIASLYLWEIASGKWDFSNDKNTKKQSLNSNHLYSKNDEKFAVYKFDFGYIKIA
    HEDEKIKLIKRVFDPLDFGTKTDLTNLVYFQLLDYFDGKKIEFNFPYFLKGTNFQKRVWNELLKIPYGKTKTYKEIAIAI
    GDPRASRAVGMANNKNPISIFVP
    CHRVVGSNGKLVGYATGVDMKEMLLKIEKKANEKL

    >gi|15828655|ref|NP_326015.1| thioredoxin [Mycoplasma pulmonis UAB CTIP]
    MDYSKYDLKKSEVEPKLKEGVKVLSFYQIGCPPCDMIKPELVKLVEKNKDKMELFLVRINRDGKHDEERRWAAESGVSAT
    PTTFIYKDGKIVNTIVGYKPLSVLEEEMSKLEMNCACSETGCATK

    >gi|15828977|ref|NP_326337.1| methionine sulfoxide reductase B [Mycoplasma pulmonis UAB CTIP]
    MNKTKEQRLKELTTLQYKVTQEGQTEKAFDNEYNNHYEEGIYVDIVDGTPLFKSQDKYNSGSGWPAFTSPIKKDEIVENA
    DFSYGLRRVEVKSKNAQSHLGHVFTDGPKDKGGLRY
    CINSAALRFIPKKDLEKEGYKEYLKLFED

    >gi|15829178|ref|NP_326538.1| thioredoxin [Mycoplasma pulmonis UAB CTIP]
    METLLWKDAREKIKKGVNFVEFAAPWCPDCVMMKPVIEQVEQEIKNLNLPVNFYHVNADESGMFRKADAEVAVLRIPTHY
    IVKDGKQVFIGYEYFPKHILVEKIKELFK

    >gi|15829179|ref|NP_326539.1| thiol peroxidase [Mycoplasma pulmonis UAB CTIP]
    MKTVFFKTNEYKLFANPIQVGDKLTFEATTTSLENYEFDVPGKLTVVSVFPAINTSVCDFQTQEISAIAKKYGDKLQVLT
    ISVDLPFTLNEWCAAHGVNNIVPLSDHKKLVFGKRNGLLIEELGLLARTVIITDEKGIVKYIDINKNVHEQVDFDKFNKE
    LEKYV

    >gi|15829184|ref|NP_326544.1| thioredoxin reductase [Mycoplasma pulmonis UAB CTIP]
    MSQNKIYDVAIIGAGPGALTAAIYTSRGNLDTVFIDNAAPGGKLIYASKIENWPGDTIVKGTDLAIRFFEHAQAFGAKYE
    YGKVVDLINIKDDLKELVLEDGKKIQAKSVIIASGMVSRKPREILNYDEFENRGVSY
    CVICDGPMYGHNPAIIIGGGNSA
    VEEGTFLSSIASKVYVIVRDSDFIAEKALVNDLKSRKNIEVLFNASVKELHGKDALEYAIVNHNGKEVKLEVASLFPYIG
    FLPSAEYAKNAGVLEPNGFIKTDEFMETKVPGIYAIGDIRIKDIRQILTATSDGTIAGKILTNRIKK

    >gi|15829232|ref|NP_326592.1| dihydrolipoamide dehydrogenase (E3 component of pyruvate complex) [Mycoplasma pulmonis UAB CTIP]
    MYKFKFADIGEGLHEGKVAEIYVKLGDTVKEGDSLFSVETDKITSDIPSPTGGVINKILFELGGTVHVGEEIFWIDDGSG
    PASDSPEPAAAEAKPAAEEHKSSAGDLFGSRRRKPGGSAAAAAPSPAPAPVAAPAPAAVAAPSVAGKVAGKAYTGAVEAE
    YDVIVIGAGPGGYLAAEEAGKYGLKTLIIEKQYWGGV
    CLNVGCIPTKALLHATEELYNLEHSHEHNGIVADFKALKIDRQ
    KTWINIQKNKKSVVDKIVGGVKFLMKAAKATSIEGEAKFVGSHELEVNGKVYRGKNIIIATGSLDRKLNLPGFEQAYKDE
    VVLSSDKLINLDSHLPETLGIIGAGVIGVEFAEVFAMAGTKVTIIQNTDAILANAPLAKEIKTELTNHLKKYGVEFKFNA
    STTKIEKNQLFFEVGGKEESMKFDKILAAVGRIPTPLNAGEVGIEIGQRNEIIVDDKLMTNVENVYAIGDVTGKNMLAHV
    AYRHAIRVVESIVGEEEVYPKQEIPGCIYTKPEIAFVGLTEQQAKEAGYDVVTSKYSFSTLGKALASSEGNGFVQLVVDK
    KYGRILGCHIIGKNSTDYIAEIVLAMDNEISVFEIAATIHPHPTYGEIVWEAARALSLKLNIEKHKK

    >gi|15829249|ref|NP_326609.1| methionine sulfoxide reductase A [Mycoplasma pulmonis UAB CTIP]
    MLFVIFYEGENMQKEIFIAGGCFWGVERYFQKVKGVLDTKACYINGGFEGVKYKEVCEGSSHVEAVRVIYDNSKITEEDL
    WKLYLRIINPYSLNKQGNDRGVQYRIGLYSYDKDLLKKFSDLNEAFMKSEGKKNYIEIQKVEDVTLAEEYHQNYLLKNVN
    GYCHINLDDIPEEYQKQ