Mycoplasma penetrans HF 2 uid57729

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|26553622|ref|NP_757556.1| NADH oxidase [Mycoplasma penetrans HF-2]
    MKVVVVGINHAGTSAIRTLLSINPNAEVVAFDRNNNISFLGCGIALTVGGVVKNTDDLFYSNPEELKSMGAKVFMNTDVV
    EVNHEQKYVKVVDLETNEERTESYDKLIYAAGSWPVDLHFKNQDLKNVEICKLYQHALKLIEKANDDDIKKVAVVGAGYI
    GVELAEAYAEKGKEVALIDFLPRVLGNYYDESFTNKLEESMVQNGVSLHLGQKVSEFVSNSEGAVKQVITDKETIDADLV
    ILCTGFKPNTELLPGLKKIQNGALVVNRKAQTSDPNIYAIGDCAAIFDAATKQYRHVALATNAVKLGIVAASQISGLENV
    IIPNIVGTNAICVFGLKYASTGVTEEVGARFGLKNLKTCEYFDNDRPEWMNTVEKVKVKLVYEEDTLRLVGAQILSFGES
    NHTEWIFALALAIQLGLNLFQIAFTDVYFLPHLNKPFNFVLSAILKSLGMKYIK

    >gi|26553624|ref|NP_757558.1| thioredoxin [Mycoplasma penetrans HF-2]
    MSSIKIGKDSNIETLINQTNITVVKYGATWCGPCKMLALVLEKLADEMGDVTFVDVDVDDDDAEMTVKSSEVSSVPLMVF
    YKNGQPVNRVLGFRPEEEIVRIIESL

    >gi|26553638|ref|NP_757572.1| 6-O-methylguanine DNA methyltransferas [Mycoplasma penetrans HF-2]
    MIYTSIYKSPLGEISIACSDNKLIGLWIEGQKHFFSKYKNDIVVNNDIEILIKTKKWLDKYFKGLNPNPKDLEINPQGSA
    FQIEVWNILSKIPYGKTITYNDIAKEIANSKGIKKMSAQAVGGAVGHNPLTIIIP
    CHRVVGCKGNLTGYAGGLDKKIYLL
    ELEKCNMDDFFLPKIK

    >gi|26553849|ref|NP_757783.1| thiol peroxidase [Mycoplasma penetrans HF-2]
    MKVDLRQPLVLENKPLTVGQKAPDFCLAKLDNFAICDVSLEDFGKKIKIISCFPSIDTGVCDMQTKKLFSEYGNNEKIVL
    LNVSSDSLFAFNKWCLANEAQNTVMLSDYRDHTFAKAYGVNIKDANLIYRSIFIIDEFNFVKYIQLSKGLTDELDFVQIK
    QAVEKVLGN

    >gi|26553911|ref|NP_757845.1| hypothetical protein MYPE4590 [Mycoplasma penetrans HF-2]
    MIKLYVKSNCLGSQKAENFLKKNNIRFERINLSFIPLDEEELFKMQTVINPNIRDIINFNSDYFNNNPESKELMMQANLR
    DVITFVMKNIDALSFPIAVDADSRSGKVKSVFVGFNESEWKILNDENYSESLDVFYTNCSKNYIFKSCCCFDEVANDNTN
    ILVNLDK

    >gi|26553963|ref|NP_757897.1| dihydrolipoamide dehydrogenase of pyruvate dehydrogenase E3 component [Mycoplasma penetrans HF-2]
    MKKYDLVIIGSGPGGYVAAEHAAKHGLKTLCVEAKDFGGVCLNKGCIPTKALLNTSKIKQYVLKAEEFGVTGINIDNITL
    DWPKVIERKNSVVKKLQMGVQGLLKTAKADMLKGEAKIVDQNTISVNEELINFDNLIIATGSSPRKFNLPGFAQGYEEGK
    ILTSDEVLNLPRIPDKFTVIGGGVIGIEFAILFAELGSKVTILQGVDRILEILDKDISAEVTKLLLSKGVTIHTDVQIQK
    YENGQVYYTKDGTEQSEDFDYCLVSVGRTPSTEIARNLPIEFAPNGSIITNDKMQTSIKHIYAIGDCTSKVMLAHSAYKN
    AVVAVDTILNKPSKMDLLKIPSCIYTHPQVATVGYTEEQLKEKNIPYYAAKYPFMHLGKALADGKTVGFIKILVSQDCGE
    ILGCHIVGEQASNYISEIALAMENESTIYTLSQTIHPHPTYAEIIWEVARKIIIENFSDKDWG

    >gi|26553964|ref|NP_757898.1| gluthatione peroxidase [Mycoplasma penetrans HF-2]
    MFKMSDFYKFKVNKINGKEIELSEYKNKVVLVVNVASKCGFVKQYENLENMYQKYKDQGLVILGFPCNQFFFQEPKTNQE
    ILSFCTTKYNVTFDMFEKINVNGKEANPLYTWLKEQMPWTARAKNVKWNFEKFLLDKNGNVKYRFESKKIPEEFEQEVVN
    LINE

    >gi|26554013|ref|NP_757947.1| methionine sulfoxide reductase A [Mycoplasma penetrans HF-2]
    MIKKIYLAGGCFWGIEQYYNLNQKIISTNVGYLNSKIDNPTYKDVCNNITDAVEAVELTYDDQVISLNEIIDLLFKVIDP
    TSINKQGNDIGRQYRTGIYSRDSNELMAIQEKINELQNNYSKLIQTEVMLVDNYYLAEEYHQKYLEKNPNGYCHINLKAK


    >gi|26554382|ref|NP_758316.1| thioredoxin reductase [Mycoplasma penetrans HF-2]
    MRIDSNYLNNPNFFDVLIVGAGPAGLTAALYCKRANLKVAFYEKETPGGKVVKTSFVENYPGFTSVSGPDLAMNFFKQVS
    ELGVKFIFGEVTKIRKVGDIFHVFSADGQARYAKAVIIATGMTEKKIGVKNEAEYYGRGVSY
    CAICDAALYKDKPVAVIG
    GGNTALEESLYLADIVSKVYLIHRRQGFRADAMVVEKVKANKKIELVLDAIPHEFLGDGKTINGIIIKNVNDNRLLKINV
    DCIFPFIGFVPTNKMVEGLEITDPNTGFILVNEKMETSIPGLFSTGDVNNKTVRQISTAVGDGTIAAIEAKRYIENNFSE


    >gi|26553781|ref|NP_757715.1| thioredoxin [Mycoplasma penetrans HF-2]
    MIKNINFIELDELNSKLSNSVKNQLVIFYADWCPYCVDNIPKTKEILDKQKFKDAIFVNISDESLDVWEEDGNTEWAVEV
    VPTYRVYKNKKLVSDHANVIDEKELSKLIKSCK