Mycoplasma mobile 163K uid58077

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|47458977|ref|YP_015839.1| thioredoxin [Mycoplasma mobile 163K]
    MVHEVVKKQIDFEKFNKDKKILVFHATWCGPCRMYGPILEEVGSKGYEIFKIDVDKDREFTREFGIKNTPSTLFFKNGEL
    KEKVIGFKSADELIDLINKI

    >gi|47458978|ref|YP_015840.1| thioredoxin [Mycoplasma mobile 163K]
    MIKHVTKSEINFKEFNKGLKLLNFHALWCGPCKLLGPELERVSEKGFEIYRVDGDKDKEFAQEMEIPGFPTSFVFKDGKV
    VETVVGFRAEEEILEILNEYK

    >gi|47459019|ref|YP_015881.1| thioredoxin reductase [Mycoplasma mobile 163K]
    MHNEKIYDVIIIGGGPAAMSAAIYASRANLSTVFIEKGAPGGKMVTTSRIENYPGFTTIGGPDLAIEMLNHAKAYKAEYK
    FGNVLKINNHGPFNKEVLLERKNEIIKGKSIIIATGMVNRVPRDIEGIEEFNHKGVSY
    CAICDGPLFGKTPSAIIGGGNS
    AVEEAIYLASIASEVHVFVKDSKFNAEEKSVNDLKLLKNVKIHMNSSILKLKGSNKLEEADVLINGKKETIKLTSLFPYI
    GFIPSVDFAKHLGITNEQGFIQTNEKLETKLENIFAAGDIRVKDIRQVATAIGDGAIAGKEVANKINSEKK

    >gi|47459067|ref|YP_015929.1| methionine sulfoxide reductase B [Mycoplasma mobile 163K]
    MKKNIDKNELKKRLTDLQWKVTQENGTERPYNNEFDNHFEEGIYIDIVDGTPLFISKDKYNSGCGWPAFTKPIDPFVIEE
    KMDFTSGMTRVEIRSKNADSHLGHVFNDGPRDKGGLRF
    CINSASLKFIKKEDLEKEGYSTYLKLFK

    >gi|47459114|ref|YP_015976.1| thiol peroxidase [Mycoplasma mobile 163K]
    MKRTVMFSDKEFELVGPQLKLGDKVTFKATSKTLESVTIDKLEKITVLTIFPSISTSICDVQTSEMSKIASEFTNFNFVA
    ISLDLPFTLKEWCGTKNVKNIEVLSDYREREFGKKYGFLIDDLFLLSRGTIVLDKSNKVIYIEQLKQVKTQIDFEKLRNF
    LKTIK

    >gi|47459330|ref|YP_016192.1| methionine sulfoxide reductase A [Mycoplasma mobile 163K]
    MICCGGRNMKTIYLGGGCFWGIEGYFQKIKGIIDTDVYYLNGGFEGVSYRDVCNASGHVEAVELIYDETLISSKEIWNLF
    SDLIDPYSINKQGNDRGVQYRSGIYAKDKAILDEFKKYNKEFEVKHGRKTAFEFKLINDKTRAEEYHQNYLIKNPNGYCH
    IDINNIEKKYLKTSF

    >gi|47459406|ref|YP_016268.1| thioredoxin [Mycoplasma mobile 163K]
    MSLQTYKWKDAQDFIEKNHNRVIYLEFATETCGDCRAMAPVVEEFVDHFKNNDKVKFLRVDAEESGLWKVTGNKWEVLRI
    PTHIVLKNNEIFRKGFEYFPKELLVEWVEEALKNTK

    >gi|47459415|ref|YP_016277.1| pyruvate dehydrogenase E3 component dihydrolipoamide dehydrogenase [Mycoplasma mobile 163K]
    MFKFKFADIGEGLHEGLVAEIYKKEGDMVKEGEALFSVETDKVTSDIPSPATGKIVKVAMAQGDTIHVGQEIYYIDDGSS
    SQSIEVKPAEIKAEAPKKAGGGASVVGEVAVSDEVMSFGKKTSSTPTSSTSIQPTSFNGKITDKYDVIVLGSGPGGYLAA
    EEAGKNGKKTLIIEKEYWGGV
    CLNVGCIPTKALLKSTEVFEQLSHASDYGLDIDVSKLKMNWKKMQERKQKVVNTLVGGV
    LALMKGNKVKTINGEAKFLAPKVVQVNGEIYEAENIIIATGSKNRKLTLPGFEEAYKSGFAITAEEAIQIESLPKELVII
    GGGVIGIEFAQIFAASGSKVTVIQNAPTIIPALDEDVIKVLSDKLISSGIQIVYNAETVKIEKDTLHYKVNGEAKTIKAS
    KIMVSVGRIPVIANAKEVGYQIGEKGEIVINEFCQTNIPGAYAIGDVTFKTMLAHVAYQHAHIAIKHLLGNGDLSYTGKT
    VPACIYTHPEIASVGMSERQAKESGRAYISEKHQMKFIGKAIASDQTMGFSKLIIDKETHEILGAHIIGAHATDLISELV
    VAIDLETTVHEIANAIHPHPTFSEIIWENARTASHKLKKK

    >gi|47459455|ref|YP_016317.1| NADH oxidase [Mycoplasma mobile 163K]
    MKKTKKIIVVGANHAGTSFLRTIRKLKPEYEVVAYDRNTNTSYLGCGTALWVGGEFHDANGLFYSNPQLLREMGVKLHLE
    HELVELKSKEKKVIIRDNNSKKEFEDSYDILVFGGGTWPIVPPLPGVNLEGIMLAKVFQHAQKIYEKANSAKVQNVVVVG
    AGYIGVELVEAFHLKGKKVTLIDMASRVIDKYFDEEFTDEMENRMRKAGVKLQFGEKLIEFKSKDGKNVSSVVTDKGEYP
    AEMVILSIGFKPLTNIKGFELFDKYQNGSIKVDQFQRSLNDENIYIIGDAASLHHNASKDFRHVALATNAVKTGLVAALD
    AAGIPVPFPGVQGTNAISVFGCHYASTGYSMSAAKTLLKEFEFKSEFILDNDRPEFMKTHSKVAFKIVYDPKTLRLVGAQ
    VGSWDKTIHTEIIYAMSLAIQKQMTLPEIALMDVYFLPHFNKPFNFMLVPILKALGIDYSKK