Mycoplasma hyopneumoniae J uid58059

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|71893368|ref|YP_278814.1| hypothetical protein MHJ_0009 [Mycoplasma hyopneumoniae J]
    MMAKISFFALGGQDENGKNCYILEIDDNIFIINSGAKIPLDSSVGVDTIIADFTYLEENQHKIRGVFITDAKNESFSALP
    WLIMKLKKIKIYSSFFTKALIIERIHKYRLSESAFEVIPITSELKINEKISVSPFPVAGSMPGTIGFCFHTEDGGIVFMA
    NYVVGNLGVYGETNFELIKKISQNPKGILMFISDSGKSNLPGKAINKLFAKNFLENFFLKADKNSRIVVSAYDEEMVSIQ
    EIIDLSIKFNRQITAYGKKYDKLYDMIYKLDKLTTNKLKKLPTFFDYKYANKQKNSVILITSSPERICYRFNRILENDDV
    YFKLKKSDYVIMLTPPINGMEQLYAKVLDQIAKSTTSIVDISESDFGLARPYKEDISEMIQLLKPKYFLPIQGLYRYLIV
    ASNIAVANKVKRQNIIVLQNKRSANFIDGSLFSRKKISKGEEEIYVSGFGIGDVCFRVLKERDALSRNGLIIVSFLFDPI
    EKKIFSTPEITTYGILSRENREAYYDIIRKIIFNNFSNIKKINDKILKELQQKSQKNIKRKLLRIFDKEPSVSVLIHNIY
    PEVKKMKKMLWKQAENELKTGVVYLEFAADW
    CNDCKMQEPVNEELSKYFKDRSDVKLIKVDAEESKLFRQKGTKYEVLFV
    PTHFIFKDGQILFKQFNYVPAEVLIEKIEKALNS

    >gi|71893437|ref|YP_278883.1| NADH oxidase [Mycoplasma hyopneumoniae J]
    MKIISIGTNHAGTSFLRTLKTIYPQAELVTYDRNTDISFLGCGIALWVSDEFSDPSGLFYSSPEQLKSMGISVNLEHDVI
    GIDRKNKEVTVKNLVTGQIFKDNYDKLVFAGGTWPIIPPFEGISLENILVSKTFTHAKTIKEKAVDPSIKNVIIIGGGYI
    GIELLEAFHKYGKKTTLIDMQDRIIPNYFDHEFTQKMEEKIRAEGINLQFGQKVMRFIADETGKKVAFVETDKGKYAADL
    VILAIGFSPNTKILADVEKTPNGAIKVDQFQRSLSDEDLYVIGDSAAMFHNVTEKHAHIALATNAVKSGIVAAFHLAGRS
    DIPFPGYVGTNAISVFGFNYASTGYSERGCSLMGLEEVATEYLEDWDRPEFMQEKAKVWIKITYHKPTLRLLGAQIGSYG
    KQFNHTEVIYFLSLAIQKRLKLTEIALSDFYFLPHFNKPFNFVVQVILNALGLSYNKKLK

    >gi|71893452|ref|YP_278898.1| thiol peroxidase [Mycoplasma hyopneumoniae J]
    MMQTKFKNKSYNLVSSLIQPGQKLEFSVSDTNFDVVEFNSFGKTTLISVFPSINTKICDFQTVSIRDLSVKYPQFRFISV
    SLDLPSAIAQWKDANLADNLEIYSDYRLRSFGLATGFLIEDVFLLNRGYIIVDSGGRVLAVESNSDVHDQIDFVKLEENL
    KKFS

    >gi|71893454|ref|YP_278900.1| thioredoxin reductase [Mycoplasma hyopneumoniae J]
    MENYDVIIIGAGPAGLTTALYASRGNLKVLILEKGAPGGKLVSQSKIENWPGDEIIDGATLALRMYKHPLKFGAKHRFCD
    VDFIETENEFDHKVYCKDGKIFQGRAVVVASGMVERKPLDIKYYLEYEGRGVSY
    CVVCDGPFYANQPAIVIGGGNSAVEE
    GSFLASIASKVYILVRDSQFNAEPMLIEDLKKNKNVEIWFNAKVLELRGKDQLESALIDHNGEKKVLEIKSLFPYIGFLP
    ATKFLEKNHRQALNQINFIDVDSYGQTKIPGIYAVGDVVSKEIRQIVTAASDGAIVGKILTNRIK

    >gi|71893733|ref|YP_279179.1| thioredoxin [Mycoplasma hyopneumoniae J]
    MPIFDIHSTEDINNKILTSPNVVIVFHQPNCGACILYENTIDEVNKKFDNQNLVIIRMNVRENPNFARENLVQGTPTSLF
    YKNGKQVRRFEGYVTTEVLEGHLKNSKLIS

    >gi|71893855|ref|YP_279301.1| dihydrolipoamide dehydrogenase [Mycoplasma hyopneumoniae J]
    MYKFKFADIGEGLHEGVVAQIYKKEGETVNEGDSLFSVETDKITADIPSPKTGKIVKVLMAEGDTIHVGQEIYHIDDGSG
    AEAEVEEAKPEAEEKPAGGASVVGEVKVSDALLSFDFGPKKAKTASAEKVLAASDSKKVEDKIEKPTNSGKIYQGQIEKE
    FDVIVVGSGPGGYLAAAEAGNAGLSTLIVEKEFWGGV
    CLNVGCIPTKAMLKTAEVFDYLDQFSDFGLSGNSDLKISWEKM
    HQRKTEVVNKLVGGVKAIVRSAKATSIFGKAEFVGAREISVDGKVYRGKNVILATGSVDRKLNLPGFDKGYRSGKIITSK
    EAINLEQKIDSIVIIGGGVIGVEFAQIFSAAGIKVTILQNLPRLLANLDSEISQIITKNLVDKGVKVITNTNILRFEDDQ
    IIYEFEGKTELITGEKILVSIGRQANSQGLAEVGIELDSRGSVIVDDQCRTNVDRVYAIGDLSAKAMLAHVAYRHAVVSV
    AAILGKTEKYQEKTVPACVYTHPEIAVVGLTEEQARQAGHDFVIGKASFSHIGKAIASGNAYGFAKLIIDKKYGEIIGAH
    IIGPVATDLISEIVIAMDSEVTVYELAAAIHPHPTYSEIIWEAARSAVTKLKKIK

    >gi|71893881|ref|YP_279327.1| methionine sulfoxide reductase B [Mycoplasma hyopneumoniae J]
    MKKEKKLDHLTELQYKVTQQNFTEPAFDNLYNNNYQEGVYVDIVDGTPLFLSIYKYDSGSGWPSFSKPIDENLIVEVLDF
    SASLTRIEVRSKNADSHLGHVFSDGPKQFGGRRY
    CINSASLKFIPKSELKSHNLGHLLEFFK

    >gi|71893921|ref|YP_279367.1| dihydrolipoamide dehydrogenase [Mycoplasma hyopneumoniae J]
    MQKYDVIIIGGGPGGHSLAAILGKNGKKVALFEQEFLGGTCVNWGCVPTKTILKSAKIKSYFDNAEKFGLNSVAKFNFKQ
    IFQRAKNNSLKLQGSILETLKNSGVDFYNKKAKVTSNHTVLAENEEFFFEKLVIATGSKPRKIKIEGAEKANLITSDDFF
    KGKIEFDELTIIGGGAISLEFAVFYASFGAKITIIEGNDRVFANFDNSIAEAANFVLDRNKVKIFTKTKVKKYENGQLLL
    EKEDKIFAHTTKNILLAIGRQPQNEAFSGLKIDLDNRGFLKINKFMQTSVPNIYAIGDITGQMMLSSTAYKHADIVAKHI
    LFGSSDEEFSAELIPWAIYSIPEIASVGKTEKQLLNLDVDFQKAKIFAKNLPRAHANGEIEAGFIELFFHSKTFEILGCN
    IFLEEASLLVNQIALALSQKLTIFDLQKMAYTHPSLSEAFYYLCRNITFSNLKK