Mycoplasma hyopneumoniae 232 uid58205

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|54019978|ref|YP_115524.1| hypothetical protein mhp009 [Mycoplasma hyopneumoniae 232]
    MAKISFFALGGQDENGKNCYILEIDDNIFIINSGAKIPLDSSVGVDTIIADFTYLEENQHKIRGVFITDAKNESFSALPW
    LIMKLKKIKIYSSFFTKALIIERIHKYRLSESAFEVIPITSELKINEKISVSPFPVAGSMPGTIGFCFHTEDGGIVFMAN
    YVVGNLGVYGETNFELIKKISQNPKGILMFISDSGKSNLPGKAINKLFAKNFLENFFLKADKNSRIVVSAYDEEMVSIQE
    IIDLSIKFNRQITAYGKKYDKLYDMIYKLDKLTTNKLKKLPTFFDYKYANKQKNSVILITSSPERICYRFNRILENDDVY
    FKLKKSDYVIMLTPPINGMEQLYAKVLDQIAKSTTSIVDISESDFGLARPYKEDISEMIQLLKPKYFLPIQGLYRYLIVA
    SNIAVANKVKRQNIIVLQNKRSANFIDGSLFSRKKISKGEEEIYVSGFGIGDVCFRVLKERDALSRNGLIIVSFLFDPIE
    KKIFSTPEITTYGILSRENREAYYDIIRKIIFNNFSNIKKINDKILKELQQKSQKNIKRKLLRIFDKEPSVSVLIHNIYP
    EVKKMKKMLWKQAENELKTGVVYLEFAADW
    CNDCKMQEPVNEELSKYFKDRSDVKLIKVDAEESKLFRQKGTKYEVLFVP
    THFIFKDGQILFKQFNYVPAEVLIEKIEKALNS

    >gi|54020431|ref|YP_115794.1| thioredoxin reductase [Mycoplasma hyopneumoniae 232]
    MENYDVIIIGAGPAGLTTALYASRGNLKVLILEKGAPGGKLVSQSKIENWPGDEIIDGATLALRMYKHPLKFGAKHRFCD
    VDFIETENEFDHKVYCKDGKIFQGRAVVVASGMVERKPLDIKYYLEYEGRGVSY
    CVVCDGPFYANQPAIVIGGGNSAVEE
    GSFLASIASKVYILVRDSQFNAEPMLIEDLKKNKNVEIWFNAKVLELRGKDQLESALIDHNGEKKVLEIKSLFPYIGFLP
    ATKFLEKNHRQALNQINFIDVDSYGQTKIPGIYAVGDVVSKEIRQIVTAASDGAIVGKILTNRIK

    >gi|54020433|ref|YP_115796.1| thiol peroxidase [Mycoplasma hyopneumoniae 232]
    MQTKFKNKSYNLVSSLIQPGQKLEFSVSDTNFDVVEFNSFGKTTLISVFPSINTKICDFQTVSIRDLSVKYPQFRFISVS
    LDLPSAIAQWKDANLADNLEIYSDYRLRSFGLATGFLIEDVFLLNRGYIIVDSGGRVLAVESNSDVHDQIDFVKLEENLK
    KFS

    >gi|54020439|ref|YP_115812.1| NADH oxidase [Mycoplasma hyopneumoniae 232]
    MKIISIGTNHAGTSFLRTLKTIYPQAELVTYDRNTDISFLGCGIALWVSDEFSDPSGLFYSSPEQLKSMGISVNLEHDVI
    GIDRKNKEVTVKNLVTGQIFKDNYDKLVFAGGTWPIIPPFEGISLENILVSKTFTHAKTIKEKAVDPSIKNVIIIGGGYI
    GIELLEAFHKYGKKTTLIDMQDRIIPNYFDHEFTQKMEEKIRAEGINLQFGQKVMRFIADETGKKVAFVETDKGKYAADL
    VILAIGFSPNTKILADVEKTPNGAIKVDQFQRSLSDEDLYVIGDSAAMFHNVTEKHAHIALATNAVKSGIVAAFHLAGRS
    DIPFPGYVGTNAISVFGFNYASTGYSERGCSLMGLEEVATAYLEDWDRPEFMQEKAKVWIKITYHKPTLRLLGAQIGSYG
    KQFNHTEVIYFLSLAIQKRLKLTEIALSDFYFLPHFNKPFNFVVQVILNALGLSYNKKLK

    >gi|54020488|ref|YP_115907.1| thioredoxin [Mycoplasma hyopneumoniae 232]
    MPIFDIHSTEDINNKILTSPNVVIVFHQPNCGACILYENTIDEVNKKFDNQNLVIIRMNVRENPNFARENLVQGTPTSLF
    YKNGKQVRRFEGYVTTEVLEGHLKNSKLIS

    >gi|54020222|ref|YP_116014.1| dihydrolipoamide dehydrogenase [Mycoplasma hyopneumoniae 232]
    MYKFKFADIGEGLHEGVVAQIYKKEGETVNEGDSLFSVETDKITADIPSPKTGKIVKVLMAEGDTIHVGQEIYHIDDGSR
    AETEVEEAKSETEEKPAGGASVVGEVKVSDALLSFDFGPKKVKTTSPEKVLVPSDSKKVEDKIEKTTNSGKIYQGQIEKE
    FDVIVVGSGPGGYLAAAEAGNAGLSTLIVEKEFWGGV
    CLNVGCIPTKAMLKTAEVFDYLEQFSDFGLSGNSDLKISWEKM
    HQRKTEVVNKLVGGVKAIVRSAKATSIFGKAEFVGAREISVDGKVYRGKNVILATGSVDRKLNLPGFDKGYKSGKIITSK
    EAINLEQKIDSIVIIGGGVIGVEFAQIFSAAGIKVTILQNLPRLLANLDSEISQIITKNLVDKGVKVITNTNILRFEDDQ
    IIYEFEGKTELITGEKILVSIGRQANSQGLAEVGIELDSRGSVIVDDQCRTNVDRVYAIGDLSAKAMLAHVAYRHAVVSV
    AAILGKTEKYQEKTVPACVYTHPEIAVVGLTEEQARQAGYDFVIGKASFSHIGKAIASGNAYGFAKLIIDKKYGEIIGAH
    IIGPVATDLISEIVIAMDSEVTVYELAAAIHPHPTYSEIIWEAARSAVTKLKKMK

    >gi|54020572|ref|YP_116055.1| methionine sulfoxide reductase B [Mycoplasma hyopneumoniae 232]
    MKKEKKLDHLTELQYKVTQQNFTEPAFDNLYNNNYQEGVYVDIVDGTPLFLSIYKYDSGSGWPSFSKPIDENLIVEVLDF
    SASLTRIEVRSKNADSHLGHVFSDGPKQFGGRRY
    CINSASLKFIPKSELKSHNLGHLLEFFK

    >gi|54020604|ref|YP_116095.1| dihydrolipoamide dehydrogenase [Mycoplasma hyopneumoniae 232]
    MQKYDVIIIGGGPGGHSLAAILGKNGKKVALFEQEFLGGTCVNWGCIPTKTILKSAKIKSYFDNAEKFGLNSVAKFNFKQ
    IFQRAKNNSLKLQGSILETLKNSGVDFYNKKAKVISNHTVLAENEEFFFEKLVIATGSKPRKIKIEGAERANLITSDDFF
    KGKIEFDELTIIGGGAISLEFAVFYASFGAKITIIEGNERVFANFDNSIAEAANFVLDRNKVKIFTKTKVKKYENGQLLL
    EKEGKIFAHTTKNILLAIGRQPQNEAFSGLKIDLDNRGFLKINKFMQTSVPDIYAIGDITGQMMLSSTAYKHADIVAKHI
    LFGSSDEEFSAELIPWAIYSIPEIASVGKTEKQLLNLDVDFQKAKIFAKNLPRAHANGEIEAGFIELFFHSKTFEILGCN
    IFLEEASLLVNQVALALSQKLTIFDLQKMAYTHPSLSEAFYYLCRNITFSNLKK