Mycoplasma genitalium G37 uid57707

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|12044954|ref|NP_072764.1| thioredoxin-disulfide reductase [Mycoplasma genitalium G37]
    MLKVNADFLTKDQVIYDLVIVGAGPAGIASAIYGKRANLNLAIIEGNTPGGKIVKTNIVENYPGFKTITGPELGLEMYNH
    LLAFEPVVFYNNLIKIDHLNDTFILYLDNKTTVFSKTVIYATGMEERKLGIEKEDYFYGKGISY
    CAICDAALYKGKTVGV
    VGGGNSAIQEAIYLSSIAKTVHLIHRREVFRSDALLVEKLKKISNVVFHLNATVKQLIGQEKLQTVKLASTVDKSESEIA
    IDCLFPYIGFESNNKPVLDLKLNLDQNGFILGDENMQTNIKGFYVAGDCRSKSFRQIATAISDGVTAVLKVRDDI

    >gi|12044976|ref|NP_072786.1| thioredoxin [Mycoplasma genitalium G37]
    MVTEIRSLKQLEEIFSAKKNVIVDFWAAWCGPCKLTSPEFQKAADEFSDAQFVKVNVDDHTDIAAAYNITSLPTIVVFEN
    GVEKKRAIGFMPKTKIIDLFNN

    >gi|12044979|ref|NP_072789.1| Spx subfamily protein [Mycoplasma genitalium G37]
    MKKAGKKNSDAGKTFILISSSCSSCQKAIEFFDQNKISYVVENFYKKPISDKRFKDILSLSEDGTESLFSKRADQIKATN
    SVSVEELSISELIKLVRERPSLLRRPIIIQYNSSGIPKRMRIGYNSSEIKVFERKLIEPKPIIQQ

    >gi|12045127|ref|NP_072938.1| dihydrolipoamide dehydrogenase [Mycoplasma genitalium G37]
    MDYDLIILGAGPAGYIAAEYAGKHKLKTLVIEKQYFGGVCLNVGCIPTKTLLKRAKIIDYLVHAKDYGITINGQAKLDWK
    QLLKQKQEVVDKLVAGVKTIIKGAKVESIEGEATVIDKNKVQVNNTTYTTNNIIVATGSRPRYLTLPGFEKAQQAGFIID
    STQALALEGVPKKFVVVGGGVIGVEFAFLFASLGSEVTIIQGVDRILEVCDSDVSELISKTLKNKGVQIITNAHVVRAEN
    NQLFYTVNGVEQSVIGDKILVSIGRIANTECLDQLDLKRDHNNKIVLNEKLQTSTTNIYLIGDVNTQMMLAHYAYQQGRY
    AVDQILNQNQVKPAEKNKCPACIYTNPEVAFVGYSEMELQKEKIDYVKSSLPFIYSGKAIADHETNGFVKMMFNPKTGAI
    LGGCIIASTASDIIAELALVMENNLTVFDIANSISPHPTMNEMVTDVCKKAIFDYFS

    >gi|108885099|ref|NP_072942.2| NADH oxidase [Mycoplasma genitalium G37]
    MKKVIVIGINHAGTSFIRTLLSKSKDFKVNAYDRNTNISFLGCGIALAVSGVVKNTDDLFYSNPEELKQMGANIFMSHDV
    TNIDLIKKQVTVRDLTSNKEFTDQFDQLVIASGAWPICMNVENKVTHKPLEFNYTDKYCGNVKNLISCKLYQHALTLIDS
    FRKDKTIKSVAIVGSGYIGLELAEAAWLCKKQVTVIDLLDKPAGNNFDHEFTDELEKVMQKDGLKLMMGCSVKGFVVDST
    NNVVKGVETDKGIVNADLVIQSIGFRPSTKFVPKDQNFEFIHNGSIKVNEFLQALNHKDVYVIGGCAAIYNAASEQYENI
    DLATNAVKSGLVAAMHIIGSNQVKLQSIVGTNALHIFGLNLAACGLTEQRAKKLGFDVGISVVDDNDRPEFMGSYDKVRF
    KLVYDKKTLRILGAQLLSWNTNHSEIIFYIALAIQKQMLLTELGLVDVYFLPHYNKPFNFVLATVLQALGFSYYIPKK

    >gi|12045270|ref|NP_073081.1| methionine sulfoxide reductase A [Mycoplasma genitalium G37]
    MKEIYFGGGCFWGIEKYFQLIKGVKKTSVGYLNSRIRNPSYEQVCSGYTNAVEAVKVEYEEKEISLSELIEALFEVIDPT
    IRNRQGNDIGTQYRTGIYWTDSSDEKIINDKFLKLQKNYSKPIVTENKKVENYYLAEEYHQDYLKKNPNGYCHIKFD

    >gi|12045307|ref|NP_073118.1| methionine sulfoxide reductase B [Mycoplasma genitalium G37]
    MSKYQKKSEAELKRTLTKLQFDVTQNAHTEPPYINEYNRNFEKGIYVDITSGEPLFISTDKFKSGCGWPAFSKPIDKNLI
    ANYRDESHGMIRTEVRAKNSDSHLGHVFNDGPSELGGLRY
    CINSAALKFIPFEEMEKLGYKDYIHLFKNK

    >gi|12045313|ref|NP_073124.1| OsmC-like protein [Mycoplasma genitalium G37]
    MLFNIFTKILSILINMALIYKTVAQTETGREGSVKTLDGFQTKLSFPKPDLSVQTENNPEQLFASAYASCFSQAVIVVMQ
    QHQFSFSKKPVVSVKVELHQENGLFHIKAGVELTTNSNDQEVGKKLIQKAHEM
    CPFSRLIRNENFLGLTLNGIKL

    >gi|12044989|ref|NP_072799.1| UDP-galactopyranose mutase [Mycoplasma genitalium G37]
    MNVILSVMLFSSPSCVNINSFDILIVGAGISGIVLANILANHNKRVLIVEKRDHIGGNCYDKVDSKTQLLFHQYGPHIFH
    TNNQTVINFISPFFELNNYHHRVGLKLKNNLDLTLPFDFQQIYKLMGKDGRKLVSFFKENFSLNTHLSLAELQLIDNPLA
    QKLYQFLISNVYKPYSVKMWGLPFAMINENVINRVKIVLSEQSSYFPDAIIQGLPKSGYTNSFLKMLANPLIDVQLNCKD
    NLLVYQDEKLFFNNNLIEKPVVYCGLIDKLFNFCFGHLQYRSLAFSWKRFNQKKYQTYPVVNMPLAKSITRSVEYKQLTN
    QGSFKPQTIVSFETPGSYAINDPRFNEPYYPINNTLNDTLFKKYWKKASKLKNLHLLGRLATYQYIDMDKAILLSIKKAQ
    QLLS