Mycoplasma gallisepticum R low uid57993

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|31544289|ref|NP_852867.1| thioredoxin [Mycoplasma gallisepticum str. R(low)]
    MKSISLKELEQVIQTSKKPIFVKFSWADCGVCKMNAPIIENAANQRKDQYDWYEIDVDKEQIWAEDQPNHQWAIKIVPVY
    MIFKNKQKVFEHVNFLAQDKLNTELDKHI

    >gi|294660356|ref|NP_853069.2| organic hydroperoxide resistance protein [Mycoplasma gallisepticum str. R(low)]
    MFKKVYETAAVAKVGREGLVKTTDGQLSLNLGFPKAMGGSHSDRLNPEQLFAAGYASCFSQAVFAVSKKLGHDLKEAPIE
    VTVQLHVQEEPMAFELRVGISLTVDLPEAKAKELMKLSHET
    CPYSKLAKPSQIIWLKVNGMDVPY

    >gi|31544534|ref|NP_853112.1| thioredoxin reductase [Mycoplasma gallisepticum str. R(low)]
    MNIYDLIVLGAGTSGIYCASYGAMKGLSSLVIEMTDRIGGQPAHVYPFKKIYDFPTANGILAKDFVDQLYQQQKPYITQG
    LITYLHNTTIQEQNYLDDQQLFELKLSDNQHVKAKKIILATGNGGFEPIKLKDELIQDQNLD
    CIHYKINDLTQYQNKDLC
    FLGGGDSAVELINQLADLKIAKSLSIIHRNHKYRAAQALVDLINKKPINQYLDQTIELIKDNKISFKDNQSGESTQLNFD
    YLIVQYGLKPLKSLECFDHLEQDLNNNFVINHHHQTSDPNIYAIGLASNFSKRPNLILSGMYEATVAIKHINDTINPYLR
    ATDYLLKE

    >gi|294660471|ref|NP_853243.2| thioredoxin reductase [Mycoplasma gallisepticum str. R(low)]
    MSYRVDGKNDLFDLVIVGSGPAGISAAIYAKRANINVCVVEGSAPGGKILKTGFIDNYPGYSSIKGPDLAVNMLNQLNSL
    SVPIFYSQVNAIEKQENYFFTYLDSKTLLSKAVIVATGTLERKLGLANEAKFETKGISY
    CAICDGPLYKNRDVAVVGGGN
    AAVEESLYLSGICNKVYLVHRRDEFRADSYAVAKLKEKKNVHFLLSHVVDSYLGDQTLKGIKVKNLKNNELTDLTIDCLF
    PYIGAVPNTSFLKPFNILNEEGYVLVDANQKTSVDGLYAAGDCVHKKIRQISTAISDGTIAALAVNDFFKLHK

    >gi|294660483|ref|NP_853258.2| peptide methionine sulfoxide reductase MsrB [Mycoplasma gallisepticum str. R(low)]
    MKKYKKKPIEVLKKELTPLQFDVTQNSATERPYTNEYDQNFKKGIYVDITTGEPLFLSTDKYDSGCGWPAFSHPIAKSLI
    NEVKDLSHNMVRVEVRAKNSDSHLGHVFTDGPTDKGGLRY
    CINSASLKFIPYEDLKKAGYEEFIAILDQEAKH

    >gi|31544686|ref|NP_853264.1| dihydrolipoamide dehydrogenase (E3) component of pyruvate dehydrogenase complex [Mycoplasma gallisepticum str. R(low)]
    MVLNMYNYDLIVIGAGPGGYVAGEHAAKNGLKTLVIERGTYGGVCLNVGCIPTKTLLQSSKVKHYIEKAAEYGLDLVNNQ
    LSVNWANILKRKEAVVNKLVNGVKTILKVAKADTIVGEARIVDGHTVTVNNQTFYITTKDIIVATGSSPRKLPLPGFDQG
    RAEGVIIESTKALELPQIPQSLVVIGGGVIGIEFAMLYASLGTKVTILQAVDRLCELLDQDASDFIAKRMKSLGVNVVYN
    AKILGYQNNAIIYEDNGTAYQLPSQYILESVGRVVNDQVFGSFNVARDDRNRIKLNDKLQTSTDSIYVIGDAAGQIMLAH
    YAYHQALYAVDTILNRKTKKLSSLTTPGCIYTYPEIATIGYTEQQLKEKNIEYVVSKMPMAVNGKAIADGSTEGFIKFMF
    GKKYGEILGCVLIASTASDMISEIALAMENELTVFELEQAIHPHPTIAEIISECAKQAIYNHFNKKH

    >gi|31544690|ref|NP_853268.1| NADH oxidase [Mycoplasma gallisepticum str. R(low)]
    MKVIVVGINHAGTSAIRTMLAENPKLDVVAFDRNDNISFLGCGIALAVSGVVKDTTDLFYSNPEQLRSMGAKVHMKHEVL
    SVDHNRKVVVVCNLEKNSTFEESYDKLILATGAWPITTADASLPFTEKYCGGIEGLVACKTYQHALEIIDQFKKPDVNNI
    VVIGAGYIGVELVEAAHQKGKKTLLVDMLPRPAANYFDKEFGTDLMTTMKKEGVDVRCGTKVMGYLVDTEGGKKVIRGIT
    LEKDGVQTKVEADLVIQCIGFLPNTSLLADAHKVKNGALIIDQYCQTSVKDVYAIGGAAAIMNAATGEYQNIDLATNAVK
    TGVVAASHINGMTNIKLENVVGTNAIHVFGHHLASTGISEEVAKIRGIQAVASYFEDADRPEWMNTYDRVKIKLVYDPKT
    LRLLGAQVGSTKNNHSEVIYLLALAIQRKLTLVDVAFADVFFLPHYNKPFNFIISAILQALGLNYFKESIKK

    >gi|294660512|ref|NP_853311.2| osmotically inducible protein C [Mycoplasma gallisepticum str. R(low)]
    MARKEYAFTAKLNPDRTVTGKTPKHELLMDSSATKGPSPLELMMNGLMGCELSVISYYGPKLFGLQLEDLEMKVQAWRDP
    EPQDEYYGLRKIEIEWFVKSNKSLEEVKEIIKYAHKVCPVFNSLSGRIVIDEKFTLK

    >gi|294660525|ref|NP_853328.2| regulatory protein spx [Mycoplasma gallisepticum str. R(low)]
    MTNNQNSQTNNIVLFITASCIGCTRVRRFFREYNIQHKEINFYKTAIEEKYFNDILSLTENGVFDIISTRSKYLQNNKVN
    IDELTISQLITLVNEHPSILKRPIILQYDKSGIPKRLMVGYNSTDIRVFLREVADVKAYYLDEYWFDNESSPSSRKEDE

    >gi|294660571|ref|NP_853415.2| thioredoxin [Mycoplasma gallisepticum str. R(low)]
    MKHITNKAELDQLLSTNKKVVVDFYANWCGPCKILGPIFEEVAQDKKDWTFVKVDVDQANEISSEYEIRSIPTVIFFQDG
    KMADKRIGFIPKNELKELLK

    >gi|294660618|ref|NP_853483.2| peptide methionine sulfoxide reductase MsrA [Mycoplasma gallisepticum str. R(low)]
    MVKKIYLAGGCFWGVEEYFKRTKRIIDSSVGYANYKPEFRNPTYKEVCSGLTGGVETVEITYDDQIISLEEIIDHFLKVV
    DPTTLNYQKNDRGTQYRSGFYFVNDDDETVIKSKLAQAQGRYSKPIVTEVLKLQNFSKAEDYHQDYLEKNPGGYCHIKFE