Mycoplasma fermentans JER uid53543

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|308189647|ref|YP_003922578.1| glucose inhibited division protein A [Mycoplasma fermentans JER]
    MNKKSNNVHKYDAVVIGGGHAGLEAAFALAHKNHKTVLISLNKERLGMMPCNPSIGGPAKGIITREIDALGGMQGLWADL
    SMIQLKMLNQSKGPAVRALRAQIDKEKYMKIALEYVLKEPNLDLIEDIAEEILVNSKKEFKGIKLANGDIVEAEVCVVTT
    GTYMDSRILRGDVIKISGPDNEKTTPKLSASLKEHGFIIQRLKTGTPPRIFSDSIDYSQVEQEVLSDTNLSFSSRSNVKL
    PRQIACYLTYTTPETHKIIEENLTKSAMYGGIIKGIGPRYCPSVEDKIVKFPSKERHQIFFEPETADGSITYVNGLSTSM
    PVEVQELMIRSIPGLQKCKIQKYAYAIEYDAIDPLQLKPTLETKIIKNFYTAGQINGTSGYEEAAAQGLIAGINAALNLE
    KKDGIVILRNHAYIGVLIDDLVTKGTKEPYRMLTSRAEYRLLLRNDNADIRLAEYGYKIGLIDKHQYQKVIKKYELIDQE
    IQRLHTTYLSSKDPVAIKYGITTGISLLQTLARPAVDPYDIIHDFPYLEELTTMVRLHGYIEKQKSDANKAVRLENYKIP
    EDLDYNKINNIATEAKQKLIKVKPTTIGQASRISGINPADIQMLMFYLETTRKKNNA

    >gi|308189710|ref|YP_003922641.1| thiol peroxidase [Mycoplasma fermentans JER]
    MNKRQETTFFKNKVTLLGDKIEVGQKAPNFTALNNELKSVQLKDFKDKVILISSVPSLDTGVCQMQTVRFNKEVEQIKGL
    KVITISCDLPFAQSRFCTSFNTNNVVTLSDHKNLDFGLKYGCVIEELRLLNRAIFVIDKNGIIQYVEYVKENTDHPNYDK
    ALKCVKNII

    >gi|308190194|ref|YP_003923125.1| putative thioredoxin [Mycoplasma fermentans JER]
    MKQVAWNEVQNMVANSNNENNIYFITFTTSWCPDCKVMKPIVESVEEEYKEYNEIIFLEVDAEKAQLFREINNRWKILHV
    PTFLIMKNNKIIQRGENYYPKEILCDWVEKVLE

    >gi|308190215|ref|YP_003923146.1| dihydrolipoyl dehydrogenase [Mycoplasma fermentans JER]
    MYVFKFADIGEGLHEGTVGEISVKVGDKIKEGDTLFSVETDKVASEIPSPVDGIIKEIRMKTGDVIHVGQEIFVIDDGKG
    GSVAAAPATKVEESKSTPATSSSTSFYVFKFADIGEGLHEGTVGEIPIKIGDKVKEGDTLFSVETDKVASEIPSPVDGII
    KEIKMKTGDVIHVGQEVIVIDAGSKNPTSSSVSSAPSSNKEEEKCLVGEAPNSSELINLDFSSLNSPAKETPQPVAPQAS
    TYEANQEEESNGVSFTSEGKKYEGKVDEEFDVIIVGSGPGGYLAAEELGKAGKKVLIVEKEFWGGV
    CLNIGCIPTKAMLK
    STDVLETLTDAAGYGIVGNLDKLKIDLQKTWVKMHERKKGVVDQISSSVKKLMIASKCKIEEGEAEFVGAHEIKINGKVY
    RGTNIILATGSHSRRLRALPGFKVGYENNYVLSSREAINYDSKLPGSVVIVGGGVVGVEFAQVFASAGAKVTIIQNQNHL
    LPGIDHDVTNEILKHLEKHGVQIIYNATSTGLNNKKELLYEIGGKERKIKADVYLIAVGRIPSSKGIAEVGVNVGVREEV
    LVDEKMRTNVKGVYAIGDLTGQNMLAHVAYQHALIAVGNILGEKNVRYHNKPVPGCIYTNPEIAFIGLTEEEAKNKGYNI
    FTSKYMFSYLGKAIATKQTSGFVKLVVDREYGQILGAHIIGAHATDYISEIALAMEQEVSVKELAYTIHPHPTYSEIIWE
    AARAASLKLYLEENKK

    >gi|308190263|ref|YP_003923194.1| thioredoxin-disulfide reductase [Mycoplasma fermentans JER]
    MDKKDIKKFDVLIVGSGPAGLNAALYTSRAGLNTAFIDNDVFGGKIQKTAKVDNYLGIQDISGFDLSQKFYEHALKYGAK
    HLYGKVVKINSINENLQEAILENGEIIQAKKLIIASGMINRYPKGVDNYQRLEEYVSF
    CAICDGALYKNRKVVVLGGGNS
    AVEEGTFLAKLCTDVTIVTNQNTFSAEEELVEELKKQKNAKIYYDHELISLNGENQLTSVTIRNKKTNKEINIVADGLFV
    FIGFIPNQDAFKHLKITTKEGFVKTNEDMETKVKGIYAIGDIRDKKVRQIITAAADGAIAAKHISDTLKD

    >gi|308190279|ref|YP_003923210.1| NADH dehydrogenase [Mycoplasma fermentans JER]
    MKIIVIGANHAGTSFLRTLKTVNPKAEITAYDRNTNTSFLGCGIAIWVGGKAKQPDGLFYSSPNILQKEYGVNLKTSHEV
    IEIDRKKKEVTVQDLDSGKTFKDTYDKLVFAGGTWPIESKIPGIELDNILLSKLYQHAQVLVKKANDKKIQNVVVVGAGY
    IGIELVEAFHNKGKKVTLIDLADRVVPGYLDGEFTGIMQKNMKKEGVKLALGEKVVEFKSKDGKHVSQVITDKSKYDADL
    VIMSVGFKPRTYVLNDVEKLPNGAIKVNEFQQSISDENIYVLGDSAALKHCVSNTYEHVALATNAVKTGIVAALNLAGLK
    VPFPGVVGTNAINVFGCHYAATGFNEDAARAHGFDVASEYFEDNDRCEFAGKSEKVGCKIIFDKKTLQILGVQIGSWGQV
    NHTEVIYMFGLALQRKLTLPECALTDVFFLPHFNKPFNFFLMPMLKALGLKYKA

    >gi|308190311|ref|YP_003923242.1| putative thioredoxin [Mycoplasma fermentans JER]
    MLKEINQDEYKNNVIGKEKGIYVLVFHALWCPPCRMFKSSLEQLDKLDNIPVYRVDVDENTKLTQEMGVNSMPTWFIFKN
    GKMMEKVMGYVPYDHLKAKVMEYK