Mycoplasma crocodyli MP145 uid47087

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|294155372|ref|YP_003559756.1| NADH oxidase (noxase) [Mycoplasma crocodyli MP145]
    MKILVIGANHAGTSFLRTLKTVNPKAEVVAYDRNTNTSFLGCGIAIWVGGEFDDPKGLFYSSPEILVKEYGVNLKTNHEV
    IKIDKKKKEVLVRDLATQKEFTDNYDKLIFAGGTWPVEPNFPGREYNNIMLSKLFQHAEEIVEKAKDKSVKNVVVVGAGY
    IGIELVEAFQMQGKKVTLIDLENRVVPNYFDEEFTSEMEKRMVADKIKLQLGEKVKEFKSKDGKNVSSVVTDKGEYPADL
    VILSIGFKPRTDVLDGVEKIANGAIVVDEFQRSVSDENIYALGDSAAMKHCVTGKPEHAALATNAVKTGLVAALHIAGLN
    VPFPGVAGTNAINVFGCHYASTGLTKQVALKHGIKDVAEEYWIDNDRPEFMTTYEKVACKITFDPKTFKLLGVQIGSWGK
    SIHTEVIYMFALAIQRGLTLPEIALTDVYFLPHFNKPFNFFLMPMLNALGIKYKK

    >gi|294155452|ref|YP_003559836.1| methionine-R-sulfoxide reductase B [Mycoplasma crocodyli MP145]
    MKKTKEELKTILTPLQYRVTQENGTEKPFDNKYDEHFEKGIYVDIVDGSVLFSSVDKYNSGCGWPAFSKPVDSLKEVSDY
    SHGLNRVEVRSKNADSHLGHVFTDGPKDKGGLRY
    CINSASLKFIPFDKMEEEGYKKYKNLFKK

    >gi|294155661|ref|YP_003560045.1| dihydrolipoyl dehydrogenase [Mycoplasma crocodyli MP145]
    MYKFKFADIGEGLHEGLVAEIFFKEGDKVNEGDSLFSVETDKVTSDIPSPVSGIIKSILMKQGDTIHVGQEIFVIDDGKD
    HPAEPETSKATSSEQGASVVGEMKVNNDLIDFSSLNNKATPATSTTTTKVKESEYQGETGKAYTGAIKEEFDVIVVGSGP
    GGYLAAEEAGKSGLKTLIVEKWAWGGV
    CLNIGCIPTKALLKSTEAIHELAHADKYGVIANLKDIKIDQTATWKAIHKRKE
    DVVNKVAGSVKMLMTSSKCKILESEAKFVGAREIEVDGQVYRAKNLIIATGSRAKKLNMIEGFDEGYKSGYVITSKEAIN
    YKTKLPKSLVIIGGGVIGVEFAQIFALSGTKVTILQNSDRILPMADVDVSKEATKALKEMGVEIIFNAQTKQLNAKKELV
    YVLDGKEVKIKPELILTATGRGPVSEGLSEVGIKLGKNQEVLVDNHQRTNVKGVYAIGDVTGQNMLAHVAYAHALAAVFD
    ILGDTQKSTYHPKGVPGCIYINPEIAFIGKTEVEAKAEGKNVFASKYLFDYLGKAIATTHTQGFVKLVVDKEYGEILGAS
    IVGANATDYIAEIALAMEQEVTVHELAHTIHPHPTYNEIIWEAARSASLKLSLEKRK

    >gi|294155801|ref|YP_003560185.1| thiol peroxidase [Mycoplasma crocodyli MP145]
    MKKLLFGEREVTSNGDEVKLGTVINLRGVKAGTFDESKPVLKNDYTVFTTLPSIDTRVCDLQILRLAEISKEYAEFNYVS
    FSLDLPTALASYLTEHQVGEIQMFSDYLDKKVSKETNLLVNELQLMNRSVFILDKDNKVVYKQINKQIRENIDFERLVEA
    MEKISK

    >gi|294155826|ref|YP_003560210.1| methionine-S-sulfoxide reductase A [Mycoplasma crocodyli MP145]
    MKKIYLAGGCFWGVQAYFKTIKGIIKTTVGYANSEIKNPTYIQVKTGSTNAVEAVEIYYDEIILKLDEIVKKLFDVIDPT
    QLNHQAHDFGSQYRNGFYFENEEDELIINNKINELSKHIKGKVVTEVLKLKNYYLAEEYHQDYLDKHPNAYCHINF

    >gi|294155872|ref|YP_003560256.1| thioredoxin-disulfide reductase [Mycoplasma crocodyli MP145]
    MNNIYDLLIVGSGPAGLNAALYASRANLNVAFIEKSAPGGKLSATSKIENWIGLGNMEGWQMATKFFEHAQEYGAKYIYG
    EVKNIINKGDFLKEIELADGSKVLSKTVLIASGMKNKIPTFIKNIDKFIDKGVSF
    CAICDGPIYGKTPTLVLGGGNSAVE
    ESVYLSKIASEVNLVIKDTDFTAEKRLVDDLLKLDNVKIFRESQITQIEGDQRLQKATIKDKNGKLTTIEVSSFFPYIGL
    EPAASFAAGLGVLEENGFILTNEEMQTKVPGIYAAGDIRVKNIRQIVTAASDGAIAAKNISDYLSSEKQ

    >gi|294155885|ref|YP_003560269.1| putative thioredoxin [Mycoplasma crocodyli MP145]
    MIKEYEWNEVLKKIDTNSEDHIIFLEFTTKWCNDCKMMAPVVNEISSKYENNKNITFLKVDAEEAQLFRNPDNKWQILRV
    PTHMVIKGNAIIEKGYEYYPKEILESWIEKSILWDDKF

    >gi|294155957|ref|YP_003560341.1| thioredoxin [Mycoplasma crocodyli MP145]
    MLHDVKKDTLGKGLESGTKLLVFYASWCGPCRMYKGSLDELSSKDGVDVYRVNIDEDKAFAAEMGVSSIPATFVYKDGVV
    LKQFMGYRPYEQLAAELKK