Mycoplasma conjunctivae HRC 581 uid59325

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|240047194|ref|YP_002960582.1| Thioredoxin [Mycoplasma conjunctivae HRC/581]
    MPTFNLSTTEEILSKIKSSKAAILVFHQPGCGMCVMFDTTIEETSAQYPELDIIRFNIRENIQYAREEGITGTPTTFFYK
    DGKLVAKEIGYFKIEKMSAILKEKSIF

    >gi|240047199|ref|YP_002960587.1| Dihydrolipoamide dehydrogenase [Mycoplasma conjunctivae HRC/581]
    MYKFKFADIGEGLHEGVVAEIYKKEGDQVNEGDSLFSVETDKITSDIPSPTTGKIVKVLMNQGDTIHVGQEIYYIDDGSG
    DIAEEPSAAAPAPKPAEPAEEGGGASVVGEVKVSNELLSFDFGSKKSTSTAKPTPAPVAAPSVADQTPKTTSLEKGKLYS
    GAIESEFDVIVVGSGPGGYLAAAEAGAKGLKTAIVEKEFWGGV
    CLNVGCIPTKAMLKTAEVHDYISHAHDYGFEGKSSLK
    ISWEKMHERKRGVVEKLVGGVKGIVRGAKAVSLEGEAKFVGAREVEVNGKVYRGKNIILATGSQDRKIDLPGFEEGYKDG
    VVLTSKEAINLEKQPKSLVIVGGGVIGVEFAQIFASAGTKVTIIQNLPVILANLDEEISKEITKKLTDMGVEIIANATTL
    AYESNGKVRYEVAGKQEVISGDKVLVSVGRVPNSQGLAEVGIKLGQRGEVETNDYCQTNIEGVYAIGDVNAKSMLAHVAY
    RHAIVAVSHISGTPEKYSSKTVPACIYTHPEIASVGLTEKQAKEQGYDFVVGKMSFGHIGKAIAGGSTQGFAKLIVDKKH
    GEIIGAHIVGPVATDLISELIVAIDLETTIYEIASAIHPHPTFSEVIWEAARNAASKLAKFKK

    >gi|240047240|ref|YP_002960628.1| methionine sulfoxide reductase A [Mycoplasma conjunctivae HRC/581]
    MKQIYIAAGCFWGAQAFFDKAKGVISTSVVYLNGGFEGVTYKQVCQSSGHVEAVEINYDENLITEKQLWNLFLQIVNPYS
    LNKQGGDKGVQYRIGIYSKSEQLLKVFAQFQKDFQASENRPNYIEILPVNDVSLAEEYHQKYLEKNPNGYCHINLDLFPI
    ELKKEKSE

    >gi|240047377|ref|YP_002960765.1| peptide methionine sulfoxide reductase [Mycoplasma conjunctivae HRC/581]
    MKKKNLEHLDELQYRVTQENYTEKPFANKYNDNYKDGIYVDIVDNTPLFLSTTKYNSGSGWPAFTAPINKDMIVEVPDFQ
    VPGRPRVEVRSKNADSHLGHVFKDGPKEFGGLRY
    CINSAALKFIPKEDLEKEGFGEFLKYFS

    >gi|240047382|ref|YP_002960770.1| putative Thioredoxin [Mycoplasma conjunctivae HRC/581]
    MKKLKWIDAQKEIETGVVYLEFSVDWCGDCKMQKFVNDQITEHYADNEKIKLIQVDAEEAELFRKKGTRFEVLFVPTHIV
    MKDGEILFKRFDYTPKEILVEQIDKALAL

    >gi|240047428|ref|YP_002960816.1| NADH oxidase [Mycoplasma conjunctivae HRC/581]
    MKIISVGTNHAGTSFLRTLKTIRPDVELVTYDRNTDISFLGCGIALWVGDEFQDPSGLFYSSVSQLESMGVKTHLEHEVI
    EINREKKYVIVKNLKTGDTFKDTYDKLIFAGGTWPIIPPFEGINLENILVSKTFTHAKEIKQKAIDPEVKNVIIIGGGYI
    GIELLEAFHKYGKKTTLIDMQDRIIPNYFDYEFTSKVESKIRKEGISLQFNQKVERFIADASGKKVAAVQTDKGIYEADL
    VILAIGFKPNTELLADLDKTRNGAIKVDKFQRSLSDQDIYVIGDSASMVHNVTKEHAHIALATNAVKSGIVAAFHLAGRE
    DIPFPGYVGTNAISVFGFNYSSTGYTEKGCGMVGIENVASEYLEDWDRPEFMQHKSKIWIKISYDKTTLKLIGAQIGSYG
    HSFNHTEAIYFLSLAIQKGMTLPEIALSDFYFLPHYNKPFNFIIQVILNALGLSYNKK

    >gi|240047579|ref|YP_002960967.1| Thiol peroxidase [Mycoplasma conjunctivae HRC/581]
    MTTKFANKEYKLTTPLIQKGQILNFEVTNTKFETIKLNKFSKKTVISVFPSINTSVCDEQTIMINTIAKKYPNVDFISIS
    LDLPTAIAQWLNINHSENITMYSDYKYRDFGQKTGFLIDEIFLLNRGFIIVDHDGKVIVVEANTNVHDQINFEKLEQYLQ


    >gi|240047640|ref|YP_002961028.1| Thioredoxin reductase [Mycoplasma conjunctivae HRC/581]
    MKTIYDVIIIGAGPAGLTTALYASRGNLKVLILEKLAPGGKLVSQSKIENWPGDESIGGADLAVRMYKHALKFGTTHLYG
    DVTKVESKGEFEHLVYTSDEKVYYAKSVVVATGMVERKPADIKNYFDFEGRGVSY
    CVVCDGPFYKGKPSVIIGGGNSAVE
    EGTFLASIASEVHILVRDAQFIAEPMLVDELMTKENVKVYFETKALELKGEDELQEIVVEQKGEVFSIPTASLFPYIGFL
    PATKFLESQKHILNSQGFLMVDKFNETAQKGIYGVGDVVAKDIRQIVTAANDGAIVGKILTNRIK

    >gi|240047644|ref|YP_002961032.1| dihydrolipoamide dehydrogenase [Mycoplasma conjunctivae HRC/581]
    MNKFDIAVIGAGPGGYSLALILAKAGNKVVIFEESFFGGNCVNRGCIPTKTLMKSARIANTLARSKDFGIDSENYYDLQT
    MFKNVANNSAKLQNAIKGGLTTSNVTIIEASATVIDENTIEANGSQYSFDKLVIASGSRPNFFKIEGAEATNVYTSDDLL
    TKNPKFDELTIIGGGAISLEFAYFYASFGKKVTIIEAAPQLFANLDESISRAAKAVIAEKGITLYEATKVLRYEDGALIL
    ENHDGHIYHKTNNILLAVGRRANNEAFASLNLKFNEKNFIEVNEFFQTSIDHIYAIGDVTGKLMLSTVAYKHGDIVAKHI
    ITGSSDEKFNARFIPWTIYATPEIASVGSSEQQLQAQGIDYEVAEIAASSLPRAHAENAFKLGFIKLIFNKKTFEILGAT
    IFLDEASLLINQIALAIKSKLTILDLQKSAYTHPTLSESIYYITRQIVFSNLDK