Arcobacter nitrofigilis DSM 7299 uid49001

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|296271580|ref|YP_003654211.1| hydrogenase (NiFe) small subunit HydA [Arcobacter nitrofigilis DSM 7299]
    MKIVIIGGGIAAVYLANNILNVDSSCSVTMLSDEEYIPYDRIHLCRLIDTKNDVESIKLELNSAVNLQLNQTISNINKDK
    KEVLSNDKTYDYDKLIIATGSTPITLLDTTLENVSVFRNVND
    CKKIEQYCKTNEVVLVGSGPIALELLDALNEMSDVKSI
    TLLIRSRHLYDKYISNESMQIMQTSFLKNKKVKISYEDEIVDTKIKNNKIEVLKTKKLNIKNPFIVFGIGIKANAKPFEK
    FIDVNRGILVNEFMQSSDENIYAVGECAEVVKDNFVAGHVKECTTQANVAISHIFEKESKPFELDVAVDMLKIGDFTLVE
    ICSSDFNNDFEKVVIESKDKKRVDEYFLKDKKLIRFIGINSNIDTAYLEKVIKENSVIDLNYLYENRELSPRGKLVCACK
    HIYYDDLKSLIVSCKIDSFSSMKEFSEAGRVCGRCKKEVDDIIIASQDLIDNKTPKKTLEEIKLEEELKRSQRSVDKFKK
    LHPKNDMDEKNLESALKMLDIGKGEINSWISMVTASMKLNPAFEDVVSEGIKNLNKIPIIWLELSDCSGNSEAFIKSSNP
    VLEDLIFDYISLDYHELLMSASGDESETILENIIKNDKGKYVLIVEGAVPLALDGKYLRIGKKGETGVELLKKCAKDAAL
    VLAVGSCAFDGGVVSAYPNPTGAVGVAQALNRDDVINITGCPTNPINIVGTLLSYMMFEELPALDKFNRPLWAYEQRVHD
    NCERRGHYELGEFVKEWGDDGAKNGWCLFEMGCKGPYANVNCPSMKFNQGTSWPVQVGHGCMGCTELGFFDKFANERVYK
    KTKEDEK

    >gi|296271624|ref|YP_003654255.1| arsenate reductase and-like protein [Arcobacter nitrofigilis DSM 7299]
    MIPVIFYEKVGCVNNTKQKKRLKDFGFNVISTDLLKTNFSKNQLLNFFENKSIKECINPNAPLVKNKEIDLDNTSDEELL
    NLMISNPILIKRPLITIGTNKFCGFDLNKILDFKLRELR

    >gi|296271700|ref|YP_003654331.1| heavy metal translocating P-type ATPase [Arcobacter nitrofigilis DSM 7299]
    MAKEKINLNISGMTCVNCSGGIEKFLNKKKGVISANVSFASSEGEFIIDDSLYSKEKLTSDIQKLGYKPEEDLKALEEEQ
    LLSFKRLRKIFFTSITLTFIMFCLMFLNIFSEETTKYLVFFIASIVQFYCGLRFYKLGIKSVINRNYDMNVLVALGTSAA
    YFYSTVVVFFPHLFPENLRFLYFDGASVIITFVLLGRYLEENSKLKASDFLKKLMNLAPVNANLIDENKNIKTVLASSLK
    PKDIVLVKSGEKIPTDGIIIEGNADIDTSMITGESMPVFKKIGDEVLSGTLNSNGTIKIEVSKESSDTTLSKIITLLKTA
    QSKQIPISRFADKVANIFVPSVIFISILAFLVWGFVFGDFQKAIIASISVLIISCPCALGLATPIAIVSSVSRGAKEGIL
    IKNPEILEEIKEIKYAVFDKTGTLTKGEITVSNTNIDEKYFELIGSIENYSEHPISKAIVSFIKDKKYDVNKEIKEIDII
    PGKGIKASFDGDEIILGNKKLLDENSVQVDESHEKFYLEELEKSNGLIYVAINKKTIGSFSLEDKLKDDAVSVIKELKQL
    NIEPILLTGDNKITAQKIADKLGIKKIYSEVLPTEKYEVIKELQKKSKVMFIGDGINDAPSIKQANIGITLNSGSDITKD
    AGDIILVHNELSSIIKSINLSIETMKIVKQNLFWAFTYNILGIPLAAGILYPIFGLMLNPMYAGIAMSFSSVSVVLNSLR
    LKIKKL

    >gi|296271922|ref|YP_003654553.1| peroxiredoxin [Arcobacter nitrofigilis DSM 7299]
    MKKLLSILLFFIPILGISQTSIYDFKVKTIDNKEISLSKYKNRVMLIVNVASKCGFTYQYEGLEKLHEKYSSKGLSILGF
    PCNQFLNQEPGTNEDIKEFCSLTYQVKFDMFSKIDVNGDDASPLYKYLKSSQSGLFGTGIIKWNFTKFLVNRDGKVVKRY
    SPSTNPSEIEDDIKELL

    >gi|296271980|ref|YP_003654611.1| thioredoxin [Arcobacter nitrofigilis DSM 7299]
    MGKYKELTQDNFEATVKEGISMVDFWAPWCGPCRMLAPVIDELAGDFEGKANICKVNTDEEQDLAVKFGVRSIPTVIFLK
    DGEVVDQMIGAASKQAFSDKINSLL

    >gi|296271981|ref|YP_003654612.1| thioredoxin reductase [Arcobacter nitrofigilis DSM 7299]
    MLDLAIIGGGPAGLTAGLYATRGGLKNVTMFEMGMPGGQITGSSEIENYPGQVEIVSGMDLMESWPKQAMRFGLKHEMNQ
    VSKVTKSGDVFTVELSDGTKQEARSVLLATGSVPKKGGFKGEKELFGRGVST
    CATCDGFFYKNKEVAVIGGGDSALEEAV
    YLAKMCSKVYLVHRRDTYRAAPSTIEHMKACENIEEVTNVIVEEVYGDASGVLGLKVKSKETGEIRDLEVPGVFTFVGRD
    VLSDSLKQDDGSYLCEVNEATEVVVDLKMRTNVPGLYAAGDVRIDAAKQVVCAAADGATAAVNIIEYLG

    >gi|296271989|ref|YP_003654620.1| thioredoxin reductase [Arcobacter nitrofigilis DSM 7299]
    MLDLAIIGGGPAGLTAGLYATRGGLKNVTMFEMGMPGGQITGSSEIENYPGQVEIVSGMDLMESWPKQAMRFGLKHEMNQ
    VSKVTKSGDVFTVELSDGTKQEAKSVLLATGSVPKKGGFKGEKELFGRGVST
    CATCDGFFYKNKEVAVIGGGDSALEEAV
    YLAKMCSKVYLVHRRDTYRAAPSTIEHMKACENIEEVTNVIVEEVYGDASGVLGLKVKSKETGEIRDLEVPGVFTFVGRD
    VLSDSLKQDDGSYLCEVNEATEVVVDLKMRTNVPGLYAAGDVRIDAAKQVVCAAADGATAAVNIIEFLG

    >gi|296272253|ref|YP_003654884.1| hypothetical protein Arnit_0713 [Arcobacter nitrofigilis DSM 7299]
    MKAISNLEQIKEIIASREALIIYFSSKSCSVCKVLKPKIEKEVSSYFDKISFFEIKIEESLEISSYFTVFQAPTILFYLD
    GKEFLKEGKNISISAFINAIKRPYEMFYGE

    >gi|296272325|ref|YP_003654956.1| heavy metal translocating P-type ATPase [Arcobacter nitrofigilis DSM 7299]
    MSKVKCNHCHLEFSESIMIKEEELNFCCKGCQGVYHLLQDQNLDSFYDKLGSKTIQPPLEVSSDLNKFDTQSFEKIYVTE
    DENGYKKVDLIIEGIH
    CAACIWLNEKVLYNTDGIIDANINFTNNKAKVVWNSKKIALSQIIEKIRSIGYNAFAYNSKIAD
    EKASLAKRDYFIRMMVAVFATMNIMMLSVGKYTGFFTGITPEVKHLMNLGEFILATPVLFYSGWIFYRGAYYGLKNRILN
    MDFLVSVGATFTYIYSVFILFGLKGESYFDSVSMIITFVLVGKYLEVLGKKSAVDTLDTIKSQIPLETTLIKDGNKIEVS
    VEDIQIGDIVELKTGDKASVDGIIIKGESSFDESSISGESLPIYKKVDDVIYSGTLNQDSLVQYRVTKTFKDSTLNSIVT
    LLEDSLASKPKIEHKANEISKGFSVMILTLSILTFFVWYYFGINLGFDYDGVNHFEKSFIVAISVIVIACPCALALATPI
    ASLIGISELAKKGLLFKEAKFIEELARTTKLVVDKTGTITNGKLSIVKAQILDENIHKLDLLYSLLDSSTHPISISIKEY
    LKNHYKDLSLKNLINVKTLQAKGMFAKYKNLEDKEFEILGGNQKLIEEFGIKYKFDSQNSVYIFAINKKVIATFELKDEI
    KDFAKEFVSDSLKNNIDVIMLTGDNENVANYIANEVGIKTVVANINPIQKAKYINKLKEEGHTVVMAGDGVNDSVALSSA
    NVSIAMGNGADISIAVSDIVLLNNSLESLNQAFIISRKTYKFIKQNLTISLIYNLVTIPLAMAGFVIPLVAALSMSLSSL
    IVVANSLRIKGK

    >gi|296272334|ref|YP_003654965.1| redoxin domain-containing protein [Arcobacter nitrofigilis DSM 7299]
    MATTKLQGNIINLLGNEVNVGDKAPVVNVVGQDLKDIEVGNKAQIIIIVPSLDTPVCAAETRKFNEEAVKTEVETVVVSM
    DLPFAMGRFCTTEGIENLKVASDFRNKDLANAYGVLIGDGPLTGITCRAVFVIDANGIVRYKEICEDISDEPNYEAALNA
    VKEVTETSCCGTCH

    >gi|296272402|ref|YP_003655033.1| hypothetical protein Arnit_0862 [Arcobacter nitrofigilis DSM 7299]
    MKLNNIKLNNDYFEFDEKFYQKINPTPLNNPHLISYNKLMFDEIALDYDEANSKDFLKFINGEKLLIGSEPYASAYAGHQ
    FGYFVPQLGDGRAINLGKVGTWHLQTKGSGLTRYSRQGDGRAVLRSSIREYIISEAMHALNIPTTRVLALIGSTHPVHRY
    YGVVETGSIVLRMSPSWIRIGTFEYFARSKGAKENVKQLADYVIKNSYAHLINDENKYEKMYYEMVDKTAILMAKWQAYG
    FMHGVMNTDNFSMAGLSIDYGPFAFMDYFNINQICNHTDSEGRYSYLNQPYVAKWNLEVLANSLKIICELDKLNEYLKTY
    FHIQEKEYLTLMTQRLGLDIHKSSDSYATLVISLLKVLQTSKTDYNQFFYELSKCKNSEEIRKVIDISIYRQALDKWLED
    YIELREFENEDFEKVQERMKKVNPKYVIKNYMLQEAIDKAEEGDFTLVNELLNIAQNPYDEHKEYERYSKATPLEFSNIK
    LS
    CSS

    >gi|296272495|ref|YP_003655126.1| hypothetical protein Arnit_0955 [Arcobacter nitrofigilis DSM 7299]
    MNIEIYYCGMCNYLPQASRLEEELINNFPKAKINLIKDSGGTFLVKVNDEVLFSKLALSEREKRFPKDNEISEKINSYYS
    MNNTY

    >gi|296272504|ref|YP_003655135.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Arcobacter nitrofigilis DSM 7299]
    MSNNNVDFSRMKFYCDENLCIDCNGCVVACKEAHEVPVGVNRRKVVTVNEGIVGKEISISMACMHCADAPCQQVCPTDCF
    YIRTDGIVLHNKDICIGCGYCLFACPFGAPQFPKDGAFGTKGKMDKCTMCAGGPEETNSHEEFEKYGQNRISEGKVPMCA
    AMCSTKALLVGDADEVALIKTYRATFKGKGIATESYGW

    >gi|296272680|ref|YP_003655311.1| ADP-ribosylation/crystallin J1 [Arcobacter nitrofigilis DSM 7299]
    MFDKRKAKELVLGALIADSYCLASHWIYDEKELKNLQINWEDLNNACSIWHKGKKAGEFTHYGDQLYFLYEFVSENEDFD
    LEKYVHFWKEKMEIYDGYIDGATRVTLENLNANKPIPCGSQSSDISVIGRIAPLLLISKTKNQFLQNVEKYVKATHDSPI
    VVEGAKFFAKVLLDVLEDIEMMESIKERKDEFSSTIQKYVKDGLATIDEESFDVIRKFGPA
    CGIDEAFSGVIHLLGKYTN
    FKEALIKNAQAGGDNSARAMILSMFFIARYGLKVIPKNLTKIKVQIDIS

    >gi|296272843|ref|YP_003655474.1| DsbA oxidoreductase [Arcobacter nitrofigilis DSM 7299]
    MQNKKTVLIVIVALIGLFFVGGYFYKQNKASEFGKVASEKAEVFQRDYSLVIGPKDAKVQLVEFFDPACGTCAYYYPFVK
    DLIKKHKGDIKLVLRYAPFHANANYAVKMLEGAREQNLFKETLELMFATQNQWLDGHGVVPRKLWIVLEKSNILDMKKLS
    KSMDNLMYDKIIEQDLDDARVLNVRGTPSFFVNGIPLQDLSGENLQKLIESQL

    >gi|296272845|ref|YP_003655476.1| hypothetical protein Arnit_1311 [Arcobacter nitrofigilis DSM 7299]
    MIKLLGILVITFLSLNAASFNWEKDYATAVKKAKEQNKPIFVMVSSPTCPECNYMKKHVFVKDEVKNFVNKNFITYHFDI
    NDQDIPKQMQFWGIPRFYFTKDGENVYKKAMGGMKEGKFMALLKENKK

    >gi|296272862|ref|YP_003655493.1| redoxin domain-containing protein [Arcobacter nitrofigilis DSM 7299]
    MKYFLLLLTTLFLFTGCDEDAKTVIKDSPSFNELKEKKNEDIYNLVTTQGKKISLEYSKDILTSKDLNGKIILINFFATW
    CPPCKEELPVFAKLTEKYPNDFEVVSILFKDEISKSDLEVFMKKYKMNFPVTVGGDNERLAKDINNIQKIPESYLFTKDG
    VLIDKFIGPVNEQALENLIIKLKDQK

    >gi|296272874|ref|YP_003655505.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ Mal allergen [Arcobacter nitrofigilis DSM 7299]
    MSQSSDLAIPLDDGKCNHLMGMNLPNVVLTSTSDKRVDLSKLKGLSVLYFYPKTGRPDIKSPDGWDEIPGAKGCTPQSCS
    FRDKNEIFEKLNVKVYGISTQSTSYQKEVVQRLHLPYEILSDEELRLTKELNLPTFDVDNMILTKRFTLICKDSKIIKVF
    YPVFPPEKNPEEVLDWIEKN

    >gi|296272997|ref|YP_003655628.1| hypothetical protein Arnit_1464 [Arcobacter nitrofigilis DSM 7299]
    MFDLEIYEIINILGLGLGMLFGIVAQKNQFCFSGSIKDYILLKSTRRGASVVFAMIVAIISTKIVGSYFDLDFTKTVYYK
    QDVNYFVVIFGGLLFGTGMMIADG
    CSNRHLIKFGQGDSKSLITLIFIGIFGFATAKGLIQGFLTPFTQNKTLLELSSMIE
    NSTMNIYLVVGILFVILLVLAKKVKRIFTLIDGFLIGLIIAAAWTITGVLGQDSMERLIDLSGISFVYPTSKSLELFMFY
    QVNYFTFPIALLCGVMLGSFFMSFFNKKYSFGCTATQKVNRVTYNMIGGALMGVGGILSIGCTIGQGLTGMSTLAFASFL
    AIASIFISGVITAKILNKSGKLPMCFIFEWNDTPPDYNI

    >gi|296273089|ref|YP_003655720.1| periplasmic protein [Arcobacter nitrofigilis DSM 7299]
    MKKIFKLMFLFSMLISLNAFASTELSKSEVNEIGKLPIFFGSGMKVLKAYKEDNFYLLRVNIQENIQELVLTADKKYLIA
    GKIYNVLSGEQVSIPNDVSILKDKEVLTYGTGNDVYYLFTDPE
    CPYCKKFESYFDQIKNDVQFKIYLFPLSFHKNAIPLS
    KYILSFKSNEDRVNALLNVTPSTKEFLDKKFTKAQDEALTNVINAQMKLGEKLGVRGTPTLYDIHGKALSWVKVLERYGV
    EVK

    >gi|296273320|ref|YP_003655951.1| thioredoxin [Arcobacter nitrofigilis DSM 7299]
    MEKIKVVCSFCNSVNSIPKKDSYKVANCGKCKESLLNTKPLNLNDSNFDLQIVNSDIPVVVDFWAPWCGPCKMFAPTFEE
    ISAKYPLKAKFAKVNTEVEQNLGSKYQIRSIPTLIIYKAGKEIQRVSGALDSTRLDMLINKYI

    >gi|296273339|ref|YP_003655970.1| hypothetical protein Arnit_1809 [Arcobacter nitrofigilis DSM 7299]
    MILRLLIFFIFLFTSNLLADNISKNNYDENKILKEAKKLDKKILVFVSRDNCPYCKIMREKVFPKVDVENIINKNFIFLE
    VNIDHDFLPFELSKNFQGMTPTFYFISKNKKILNRYLGAWTKKDFLFILNENIKK

    >gi|296273341|ref|YP_003655972.1| rhodanese domain-containing protein [Arcobacter nitrofigilis DSM 7299]
    MTILKKITIATLVSTMCISSVFAEKIVPISKGVKSIEMNLNGEKFTLMRNQTAGNKITPLYNRTDNGVPQPMILSEGVET
    LGELEFIDYMKKAQSDKSIAIIDTRTPGWFVRLRVPGAINVPYTNFDEKDTAIEMMEDEMGVVQKDDGTLDFSKAKTLAL
    YCNGYW
    CGQTPAMVKNAKFSLLKMGYPASKIKYYRGGMQAWTSLGFTVIGDGK

    >gi|296273466|ref|YP_003656097.1| arsenate reductase [Arcobacter nitrofigilis DSM 7299]
    MEEITIWHNPRCSKSRDALNHLQEKKIALGVIKYLDAKLTKEDMKEVLQMLNMSARELMRTKEDIYKELNLKDENDEEKL
    IEAMINNPKLIERPIIIKDGRAVIARPLEKINELF

    >gi|296273524|ref|YP_003656155.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Arcobacter nitrofigilis DSM 7299]
    MKKFDLIIIGAGRASNLAVTAGKAGKKVALIEKSTLGGTCPNRGCVPSKLLIGFAHVANAIKDSNRHFIDSTINKIDLEK
    IFQDTNEYISKVDEKYEHRFNENVEVFKGTGSFVSNNIVQVNEEQLTAPKIVIATGTKPKKPEHDKAWTSDDIFPLKGKI
    PKSLTIVGSGFIACELASFFSALGVETTLLARSQHILGKEDYEIQEVFKNEFSKKVNIEFNTSAKDVEYKNEHFSMTLEN
    KDGTNKTHISEALLYAIGRESNTSSLKLENTSIQTTPKGYIKRDEFFETSAKGVYVVGEAAGVYMLQHAASYEVNHLGKI
    LLEDCKEPLHFKYMPHAVFTEPEIASVGITEQEAKEKNIEYLATTTNWLASAKAMSTRLKYPITKFITNPKTYEILGCHM
    IGPESSTMIHQVLAVMHINNDIRHLKEMLYIHPAMSEALLPAAVTAVKEIEKYNK

    >gi|296273531|ref|YP_003656162.1| thioredoxin [Arcobacter nitrofigilis DSM 7299]
    MAKYLELDQTNIEDTVKEGVSLVDFWAPWCGPCRMIAPVIEQLAEEFEGKAKICKVNTEVEQDLTVKYEIRSIPTILFFK
    DGEIVDQLIGTTTKGALEEKINKYL

    >gi|296273532|ref|YP_003656163.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ Mal allergen [Arcobacter nitrofigilis DSM 7299]
    MIVTKKAPDFTATAVTADGQIVEDFNLYENIGEKGAVLFFWPLDFTFVCPSEIIAFSKRVDDFEERGIQVIGCSIDSEFA
    HFAWRETKVEEGGIGRVKFPMVADITKQIAKDYDVLFNESVALRGSFLIDKDGTVRHAVINDLPLGRNIDEMVRMVDTMI
    FTNENGEVCPAGWNKGDEGMKANKEGVAEYLGKNESKL

    >gi|296273562|ref|YP_003656193.1| rhodanese domain-containing protein [Arcobacter nitrofigilis DSM 7299]
    MNENIIYAFIALLAFIAYKKYSQYKVLKLVPSLLSQGGQIVDVRSVEEFVSSHKDGSINIPLDSLKNRIKELDNTKPIIL
    C
    CASGSRSALAKRTLVANGYENVHNAGKWSSLLKF

    >gi|296273624|ref|YP_003656255.1| redoxin domain-containing protein [Arcobacter nitrofigilis DSM 7299]
    MQFKKIAFLTFFITIFFAACGSDNSKNDKKVQNVEVKDFKLTTTDAQTLNIKKLDDGFAFQEYKGKAVLVNFFATWCLPC
    KAEIPNLIHLKDKYKNDLEIVSVLMEENKPNNQVKDFVNEYNINYVVTNSRQNATFAEAVGGVKAIPTMFLYDKKGKLIQ
    TYVGIVPEEMIDVDIQKAIK

    >gi|296273734|ref|YP_003656365.1| AraC family transcriptional regulator [Arcobacter nitrofigilis DSM 7299]
    MNKLEEKSKYYEDIKKAIGYFDENYSFQPNLDEVAKYVGMSKHHFSRIFKEYVGVTPMQFLQATTFSYAKEKLLNSKSIL
    DTSIDLGLSSSSRLHELFVNFIGVTPNEYKKMGENLDITYGFGFSTFGKTMLASTKKGICALEFYDDSYAEVLKRLKSSW
    ESANFIQDDKKAQKLLDKIFINNEKTDIFIKGTNFQINVWKALINIPKGKVLNYSDVANLLGKPKAVRAVASAIGANHIA
    YLIP
    CHRVISKSATMAGYRWGINRKRVILAYEEVKK

    >gi|296273735|ref|YP_003656366.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ Mal allergen [Arcobacter nitrofigilis DSM 7299]
    MKDKIKKYLKEGIIIVLMLIIAMNGISYYKSLDLNKDRLDINTFTLLDGKTYDIPKDKPVLIHFWAAWCPICKVEASNIE
    KISKEYEVITIAVQSGSKEEIQKYLKDNKLTFKVVNDEDGLYSQKFNIKGFPTTFIYNKDKKLRFSEVGYTSTIGLYIRM
    LLSK

    >gi|296273753|ref|YP_003656384.1| hypothetical protein Arnit_2225 [Arcobacter nitrofigilis DSM 7299]
    MKKIDTFDELTKLSDYSFVENLNCDPDAKSNADNKTPREVFSGHYVPVEPTALKEPIYLSHSANFCEELGFTQNLIKSED
    FIKMFSGDISNVPKPMKNLGWATGYALSIYGTEYYAQCPFQTGNGYGDGRAISVLEAVINGKRWEFQLKGGGKTPYCRGA
    DGRAVLRSSVREFLAQEHMHSLGIPTSRSLTLFTSKKEQVSRPWFRGNSYSKDPEVMIEEDVAITTRVAPSFIRVGQLEL
    FGRRARKNEHPKALEELEMLVLHLIDREYSELINENLKLEEKLILLANEFKNRLTSLVANWIRVGYCQGNFNSDNCAAGG
    FTLDYGPFGFIDMFDPKYQSWTGGGLHFSFFNQPQAAYKNFQSFCSALKPLLNSHPDSLQELEKIENSFPLAMQEEIDNM
    WAKKLGISKFDLELFSELIDLMIETKVDYTIFFRELSNIPENVKALRKSFYSADFENEDINSRWNNWLEKWKSHLDISSK
    KSKEKVSNQMKLTNPKYTLREWYLVEAYQEAENEDYKLIEELQGIMTNPYDEQTKEIEEKYYTKKPLDFFGIAGISHVS
    C
    SS

    >gi|296273831|ref|YP_003656462.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ Mal allergen [Arcobacter nitrofigilis DSM 7299]
    MLEVNSIAPDFCAPNQDDVEICLRDIKGSWIVLYFYPRDNTPGCTTEACDFTASMPEFDNLDATILGVSPDTPAKHRNFI
    EKQNLSITLLADVEKKMCEDYGVWQLKKFMGRESMGVVRTTFIINPKGEIAAVWEKVSVRKKKKVNGETIEILHVDEVKE
    KLQELQTK

    >gi|296273909|ref|YP_003656540.1| peptide methionine sulfoxide reductase [Arcobacter nitrofigilis DSM 7299]
    MPFNKLTEEEIRVIENKGTERPFSGKFNDFYSDGIYKCKKCDTKLYSSDAKFNSSCGWPSFDDDFGTVKRVQDSDGRRTE
    IVCENCGAHLGHVFEGEGFTSKNTRH
    CVNSISLNFDYINKTNEDQTICYFAAGCFWGVEYHFEHLKGVYSAVSGYMGGDT
    LHPDYHSVCTGTTGHLETVKIEYDKKVVSFEELVKYFFEIHDFTQKNGQGPDIGSQYLSAIFYKNDEQKNKALEILDELE
    SKGYKVATTLREAGTFYEAEEYHQNYYDRHQKVPYCHTYKKIF

    >gi|296273912|ref|YP_003656543.1| peroxiredoxin [Arcobacter nitrofigilis DSM 7299]
    MSIYDFKVKDAYGNIVNLDKYKGKVLLIINSATECGFTSQYEGLQLLYEKLKGEKFEIIDFPCNQFGNQAPGTNAEIASF
    CNSRFGIQFPIFGKIDVNGNNAEPLFSYLVGQKGFEGFDAKHPLSKGLDEMLAKVDPNYKNDPSIKWNFTKFLIDKNGNV
    VTRFEPTVDIEVIEEQINALL

    >gi|296273928|ref|YP_003656559.1| rhodanese domain-containing protein [Arcobacter nitrofigilis DSM 7299]
    MKIIGIVVLTLIVIFLIYKYIQVSNIDKNSNLISTAKGIILDVRPNKAYESNHIKGAINISMNDIFEGAYKSLDKKQTYY
    IY
    CYLGLMSIKVSTFLKEKGFENIINCGPMSEVNKYINCVK

    >gi|296273987|ref|YP_003656618.1| rhodanese domain-containing protein [Arcobacter nitrofigilis DSM 7299]
    MIKKIDINSDEFQTTFELTKQFTDKVCEEYGFVYNPEDDVNESIQMGLTRNKLIYDKRYCPCFMVIGETQEEKDKEDNRL
    CPCTPALKKEIPSQGHCHCGIFCTKEYVDSLDNSTKEKEEVVHSKGFTKEECENILKKSQISASEVEALLEARELGFINF
    NLVDVREWMEWAGHRIKGTDFLVPTTSFYQSIEVLEDKKDIPVVVY
    CHSGSRSAYCQNIMLSAGFKTVCNLDYGIMTYQG
    ELVSGE

    >gi|296274047|ref|YP_003656678.1| redox-active disulfide protein 2 [Arcobacter nitrofigilis DSM 7299]
    MKIEILGTGCTKCKALEENAKKAVADAGIFAQVEKVEDIQKIMEYGVMSTPALVINGEIKSTGKLLNSEEIKAFF

    >gi|296274130|ref|YP_003656761.1| dihydrolipoamide dehydrogenase [Arcobacter nitrofigilis DSM 7299]
    MSKIIDILIPDLGADKDVDLIDVMVNIGDKVEEEDGLITLETEKASMDVPTTHGGTIKEILVKVGDKVNSGDLIARIEVE
    DEASATPAVEEKVQEVPAAVKPAKTSTNTNGAEEIKGQVLVIGAGPGGYSAAFRCADLGLDTVLVERYTTLGGV
    CLNVGC
    IPSKALLHVAKVMEEAEHIEHAGIKFAKPEIDLPSIAAYKSGVVKKLTDGLSAMSKMRKVTVVQGYAKFLDKNSVIVEHT
    DVEGKQTKVSFDNCIIAAGSQSSKMSFIPHEDPRIWDSTDALEVKEVPKRLLVMGGGIIGLEMGTVYQKLGSQVDFVVRG
    KQLMSGTDADIVKMYTKSNTKRFNIMFETQAQSIIPKQDGVYVEFKGKNAPEGAVVYDAILVAMGRSANGNKLDLQNCGV
    NVDDYGIIKVDNQMRTNVPNIYAIGDIVGQPMLAHKAVHEGHVAAEVIAGEKVFFEPKQIPSIAYTFPEIAWAGMTENEA
    KAAGVNYEVATFPWSASGRALASDVSSDGMTKLIFDKDTHQLIGGALVGDNAGELLGEISLALEMDCDAEDIALTIHAHP
    TLHESVGMAAEIFHGSITDLPNAKAKKR

    >gi|296274258|ref|YP_003656889.1| DsbA oxidoreductase [Arcobacter nitrofigilis DSM 7299]
    MNYKKLICIFSIMTISLSAANFDNDVISFEKKRLSNNARVEIKDVKISVKQKMPEPMTNWYGFIIDISAKVKDKEINAKD
    IIFSNGEIVAPELINLKTGASYKDLLQPKLDASYYQENHLIAGNAKAKDKIVVFSDPL
    CPFCIEALPDLIDHVKDNKDEI
    ALYYYNFPLLRVHPASATMVKAIDVARQMGIKDVERKVYTTNWEKYFPVDSKDEDKILSAFNKEFKTNITKEQINSTEVM
    ARVLDDVKMGDDVMVKGTPTIFVNGKKDDSRLKYETLGSK

    >gi|296274270|ref|YP_003656901.1| alkyl hydroperoxide reductase/ thiol specific antioxidant/ Mal allergen [Arcobacter nitrofigilis DSM 7299]
    MLVTKKAPDFTATAVLADGQIVEDFNLYENIGEKGAVVFFYPLDFTFVCPSEIIAFSKRADEFKERGVSIIGVSVDSQFS
    HFAWRETPIENGGIGRVKFPLVADLSKQISKDFDVLFGESVALRGSFLIDADGTVRHAVINDLPLGRNIDEMIRMVDTML
    FTNEHGEVCPAGWQKGDEGMKDTTEGVAEYLSKNADKL

    >gi|296274377|ref|YP_003657008.1| arsenate reductase and-like protein [Arcobacter nitrofigilis DSM 7299]
    MITVYGIKTCGSVQKALKFFKENNIEVDFFDFKKETPSAQKVKIWSQKADINILFNSKGTKYKTLQLKELNLDANGKYEW
    LCKEPMLFKRPVIEFDDKLIVAFDEELYKKTFL

    >gi|296274415|ref|YP_003657046.1| cytochrome c biogenesis protein transmembrane region [Arcobacter nitrofigilis DSM 7299]
    MKKLVFLLFSFIYLFAAQEAFLSPSEAFKESFETRNNSLNINLDLGKEIYLYANKVSVKIKKPQEIDITKELVLPKPIPY
    EEYIIYLHNLNIDVPFSLLKSKVDAKEYEIELNFQGCSKAGLCYAPMSKTTLVKIPDDFVAQSTTSSTSSTKSSNDLNET
    DTIANSLKDGNSFIILLTFFGFGLLLSLTPCVFPMIPILSSIIVKAGQNEQLTTKRGFFLSLVYVISMSFAYTIAGIIAG
    LFGANLQVALQNPYVLSAFAAIFIALAFSMFGYFKLELPQSIQNKINKTTEGKEKQGVFGIAIMGFLSALIVGPCVAPPL
    AGALVYIGQTGNAVLGGAALFVLSLGMGVPLLLIGLGAGRFMPKPGGWMENITRIFGIVMLAIAIWMLDRVLEPIIVMYL
    WALLFLGTALYLKLYEHILMKLITLVILIYGVLTFVGAVSGATNVLNPLEKFTSSKVVSASQAGITFKRIKNLQELEAEI
    KKSDKPVMLDFYADW
    CVACKEFEATTFKDAQVIQKLKGFTLLQADVTDNNQDDKELQKKFSIIGPPGIIFWDKDNNEINA
    SKIVGYKNSKEFLEILNKHF

    >gi|296274416|ref|YP_003657047.1| thioredoxin domain-containing protein [Arcobacter nitrofigilis DSM 7299]
    MKKFIIVLSLFVTSLFAFEHLTVDNMAEKIKDKNVIVDFYASWCPPCKIVGKNINEYADTKPDEVTIYKVDIDAQRELVT
    KYGVESIPTVLYIKNGKIVKSIVGIQSVSDINSNVNKYLLK

    >gi|296272747|ref|YP_003655378.1| FAD dependent oxidoreductase [Arcobacter nitrofigilis DSM 7299]
    MHDYLIIGAGIIGLNIAKNLKERFPDSKILVIEKEPEVAMHSSGRNSGVLHAGFYYTANSLKAKFTKEGNLALKKFCKER
    NLKLNECKKVVVATNEDELIGLLELKNRGDANGVELQWLREEELNSLYPNVKTYEKALL
    CPSTATVNPKEVTKEFAKVIQ
    ELGVELLLDCKYISSSKDAVLTSKGEFYAKKVINCAGLYADKIARDYGFSKDYVIIPFKGVYLKDKTNVSQLRTNVYPVP
    NLANPFLGVHYTLTVDNESKIGPTAIPAFWRENYKGFDNFSLKEFLEVSYYELKLFITDAFSFRSLAFSEIKKYNFKYFK
    NLAMKLTKNMNHDGFNSWSTPGIRAQLLNKHTLELVQDFVVESDENSVHVLNAVSPAFTSSIPFANWVVEEHILK