Mycoplasma arthritidis 158L3 1 uid58005

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|193216457|ref|YP_001999699.1| thioredoxin family member [Mycoplasma arthritidis 158L3-1]
    MITKTTKADLENRHLTGKAILAFRAKWCPPCQMMGPELEKLALENPDINVFDFDIDEEVVFAREMGVSSIPSLFIYQDGV
    QINNTVGYIPATSLVKLFK

    >gi|193216458|ref|YP_001999700.1| thioredoxin family member [Mycoplasma arthritidis 158L3-1]
    MIIKTTKVDLENRHLTGKTILAFRAKWCPACQMIGPELEKLVSENPDINVFDFDIDEEGAFAREMGVSSTPTLFIFQDGM
    QINNNVGYIPATSLVKLFK

    >gi|193216611|ref|YP_001999853.1| rhodanese-like domain protein [Mycoplasma arthritidis 158L3-1]
    MKKRLVFISILSSLTLLSSTSLLALSCENKISQTFSPKKLTTQEAAEMILKEKNNSNFVLMDIRTPGEWAEGYLKGAQKL
    DFRNENFSNELDKLDKNKTYLIY
    CRTDNRAQKAVELMRQKGFRHVYWMEQGYTKWSKEGREVYRPVEKENVYDLEISATK
    NTFKATSDLKITSKVNNLGYGKALETYNLSLELIDEKGSVLATKTLTNQQNGSEFNFESVFDSNLINQSGSIYTIKASLV
    IDNKVVANGIYKFKISNNATQLTKEDYRKNGAFDHFSDSKYDELNNEFLNENFGKNLLKYTVTNNKGEQKQLTDLIDKKK
    KTLALFATTTCLPCLEALKKLNNVDLDKFNYLKMMTSIDENDINGSIKKSEEVFDSENLKDQKDSTYYDANDFIWRDRMR
    FRTTPKLALLDEYGNVVNISEIDTSSDGAFIKSLKKIIKNTFNEDVDYKQNDDPQEKLQPDPSNPGNSNQDSKPKQDQES
    PDASKPDPKPNPEPDDPNLKNLTEYRTYEQRKKLHTLYQYDSDGHLKELYAKNLGHLVLRKSNGETITLKELLKDNDKPI
    ALIYGATYCSHCMKAMRKYSNQDPSSLPYRLVYVMYHRGSNSSWNAVTQANGFDESKDKYLFRTGDWEIGKLANRVKAIP
    KVFILDKKMNVSDFLFSHTAMIDSWVEKIGNFLATNDESLTHKKD

    >gi|193216791|ref|YP_002000033.1| thioredoxin reductase [Mycoplasma arthritidis 158L3-1]
    MAKYDVLIIGAGPAGLTAAIYLARNNMDVAFIESYAPGGKIIEQSKIENYPGFDNITGPSLATHFYNQATRNGASLIFGK
    AIKIISNGDFDKTVIMESGEEYHAKAIIIATGMKNRIPSDIVNIEKFNHRGVSY
    CVLCDGVIFKNQPCAIIGGGNSAFEE
    SISLASLASEVHIFVRDGIIAEKRLVDDVKKHSKIIVHENSQVLELIGQDELEAIKVNINGEVSEMKIKGLFPYIGQLPA
    TDFLDKEILNERKFIEVDHNMETKIKNIFAAGDVVAKDVRQITTATSDGTIAAKTINSRIVK

    >gi|193216960|ref|YP_002000202.1| 6-O-methylguanine DNA methyltransferase [Mycoplasma arthritidis 158L3-1]
    MFKSLYNSPLGILTLISDGEYLIEVNYENSDNKIFKENKLQIKDDLEIFLQTKKWLDIYFSGGNPSEMPQIKLIGSDFQK
    EVWEQLLQIPYGYVTTYKEIANEIANKRKIKKMSAQAVGTAVGKNPLSIIVP
    CHRVVNVDFKVGNYTGGVDKKYYLLEKV
    EKFCIKNNCLKIK

    >gi|193217003|ref|YP_002000245.1| peptide methionine sulfoxide reductase A [Mycoplasma arthritidis 158L3-1]
    MKKIYVAGGCFWGVQGFLKTIKGIKKTTVGYANSLLENPTYELVKSHVTDAVETVEVIYDENILSLKDIVKKLFAVIDPT
    ARNYQGPDHGRQYRNGFYFVDQEDGVMLRELMLEFSKKYEKPLATEILPLDNYYLAEDYHQDYFDKHPNAVCHIKF