Mycobacterium vanbaalenii PYR 1 uid58463

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|120401809|ref|YP_951638.1| dihydrolipoamide dehydrogenase [Mycobacterium vanbaalenii PYR-1]
    MTHYDVVVLGAGPGGYVAAIRAAQLGLSTAIVEPKYWGGVCLNVGCIPSKALLRNAELAHIFTKEAKTFGISGEASFDYG
    AAFDRSRKVADGRVAGVHFLMKKNKITEIHGYGKFTGPNSIEVDLNDGGTEKLEFDNAIIATGSSTRLVPGTSLSENVVT
    YEDQILSRELPGSIVIAGAGAIGMEFAYVMKNYGVDVTIVEFLPRALPNEDAEVSKEIEKQYKKLGVKILTGTKVEKIQD
    DGSTVTVTVSKDGKTDELKADKVLQAIGFAPNVEGFGLETTGVQLTDRRAIGIDDYMRTNVQHIYAIGDVTAKLQLAHVA
    EAMGVVAAETIAGAETLALGDYRMLPRATFCQPQVASFGLTEQQAKDEGYDVVVAKFPFTANGKAHGLGDPTGFVKLVAD
    RKHLELLGGHLIGPDVSELLPELTLAQKWDLTANELARNVHTHPTLSEAMQECFHGLVGHMINF

    >gi|120401881|ref|YP_951710.1| redoxin domain-containing protein [Mycobacterium vanbaalenii PYR-1]
    MSRVVALMRALFAACAATAVLAGCATGSDAVAQGGTFEFVAPGGQTDIFYDPPDKRGTPGPLSGPDLMDTDRTISLDDFA
    GKVVVVNVWGQW
    CGPCRTEITQLQQVYQATRDQGVAFLGIDVRDNNIDAPRDFIIDRGVTFPSIYDPPMRTMIAFGGRYP
    TTVIPSTVVLDREHRVAAVFLRELLAEDLQPVVERLAAER

    >gi|120402136|ref|YP_951965.1| DSBA oxidoreductase [Mycobacterium vanbaalenii PYR-1]
    MTNPPVSVDFHFDIMCPYAYQTSRWIRAVRDQTGLHVNWRFFSLEEINRQEGKKHPWEREWSYGWSMMRIGALLRRRSMT
    DVDAWYERAARALHVEGHKPHEKAVARHLLEELGFDPGLVDEAVADPTASDEVMADHNRVVDAGGYGVPTLFFPDGQCLF
    GPVLIDPPAGEAALRLWDAVVAWTEFPHLYELQRPKSTADQLAIAEAFRPYLEARDWVSINRGKVVGFDDLR

    >gi|120402177|ref|YP_952006.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Mycobacterium vanbaalenii PYR-1]
    MHWSPIRKTAGRSGEGPRSAARIRGTERFVEFECAVVGAGAAGLSAALVLGRARRTTIVIDADDPSNRASPVIGGLLGYD
    RRPPDELYAAGRAELGEYPSVEFRRGEVRDGRRIDRGFLLDVDGAQIRARRVLLATGMSYCPPQLPGLAELWGRSVFQ
    CP
    FCHGWEMRDGKLAALASGEQGLHTALMLRGWTDDVVLLTDGSSGLSADDKQVLHRAGVTVDDRRVVELTGTDGRLESIAF
    ADGTRLARDGLLVEAPVRQRSALAAQLGATCTPGPLGTEPLAVDTMARTSAGGVFAAGDVCTEQPHIAGAVASGSQAAMI
    VVQSLLADEYGLPFPPG

    >gi|120402431|ref|YP_952260.1| peroxiredoxin [Mycobacterium vanbaalenii PYR-1]
    MTVNEMPTPVVTMPRIGDPAPSFTAATTQGDINFPADYLGRWVILFSHPADFTPVCTSEFITFASMQDEFAAYNTDLVGL
    SVDGLYSHIAWLRTIKEKISYKGMRDVEVTFPLIDDVTMEVARKYGMIMPGEDTTKAVRAVFVIDPEGVVRTIIYYPLST
    GRNFDELLRVVKALQTADAFDVATPADWRPGDAVIVPPAGSCGTAQSRMSGDVVGVECQDWFFCTRELPADEVEARIRRR


    >gi|120402534|ref|YP_952363.1| OsmC family protein [Mycobacterium vanbaalenii PYR-1]
    MDKVLYTAEALATGEGRDGHGRTSDGRLDLDLAIPKEMGGTGNGTNPEQLFAVGYAACFHSALRLVGRQEKVDVTDSAVG
    ARVQIGPNGNGGFGLAVELEVTLPNVDHDTALQVTEKAHQV
    CPYSNATRGNIDVKLVVTDD

    >gi|120402625|ref|YP_952454.1| flavoprotein disulfide reductase [Mycobacterium vanbaalenii PYR-1]
    MAPLPSGGTCAGTPRPRRWPRFTTVVTRIVIIGGGPAGYEAALVAAGLGRDLTQVTVIDSDGLGGACVLYDCVPSKTFIA
    STGVRTELRRAQGMGFDIGIDDAPISLPKINNRVKTLAASQSADIGSQLLNQGVTIIGGRGELVDDIAGMAHHRVKVTTS
    DGKVGVLKADVVLIATGASPRVLPNAVPDGERILTWRHVYDLDELPEHLVIVGSGVTGAEFCNAYTELGVTVTVVASRDQ
    ILPHEDSDAAAVLEEVFAERGVTLVKNARADSVTRTETGVKVSMADGRTVEGSHALMTVGSVPNTKNLGLERVGITLNPG
    GYIPVDRVSRTPAPGVYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVSPIRLRTVASATFTRPEIAAVGIPQSAIDDGS
    VPARTLMLPLSTNARAKMSLLRHGFVKIFCRPATGVVIGGVVVAPIASELILPIALAVQNRISVSDLAQTLSVYPSLSGS
    IVEAARRLMAHDDLD

    >gi|120402647|ref|YP_952476.1| alkylhydroperoxidase [Mycobacterium vanbaalenii PYR-1]
    MDGEQHYHDVLAELRPEHRALRQMIPEVYQGFNAISEASLADGALSRKVKELIAMTIGIVQGCDGCIASHAKGAARAGAT
    QEEAAEAIGVSIMMHGGPATIYGARAFSAFTEFAGKTAAT

    >gi|120402675|ref|YP_952504.1| rhodanese domain-containing protein [Mycobacterium vanbaalenii PYR-1]
    MDTPSAKTTPHLPGRLVHVPLPADPSPALQSYAHPERLVTADWLSGNLGRPGLAIVESDEDVLLYDTGHIPGAVKIDWHI
    DLNDPHVRDYITGEQFADLMNRKGISRDDTVVIYGDKSNWWAAYALWVFTLFGHPDVRLLDGGRNLWISDGRDTTLDVPS
    KQTTGYPVVERNDAPIRAYKDDVLAILGTQPLIDVRSPQEYTGERTHMPDYPEEGALRGGHIPTAVSIPWAKAALDNGKF
    RSRAELEELYGFLKPEDKTVVY
    CRIGERSSHTWFVLTHLLGKPGVRNYDGSWTEWGNAVRVPVAVGEEPGTA

    >gi|120402796|ref|YP_952625.1| molybdopterin biosynthesis-like protein MoeZ [Mycobacterium vanbaalenii PYR-1]
    MSTPLPPLVEPAAELTREEVARYSRHLIIPDVGLDGQKRLKNARVLVIGAGGLGSPTLLYLAAAGVGTIGIVEFDLVDES
    NLQRQIIHGQSDIGRSKAQSAKDSIAEINPLVNVVLHEFRLEPDNAVDLFAQYDLILDGTDNFATRYLVNDAAVLAGKPY
    VWGSIYRFEGQISVFWEDAPADEAGNERGLNYRDLYPEPPPPGMVPS
    CAEGGVLGILCASVGSVMGTEAIKLITGIGETL
    LGRLMVYDALDMTYRTIKIRKDPSTPKITELIDYEAFCGVVSDAAAEAAAESTITPRELRELMDSGKPLALIDVREPVEW
    DINHIEGAELIPKGAFESGEALSKLKVDRTPVFY
    CKTGIRSAEVLAIVKKAGFSDAMHVQGGIVAWGKQLEPDMVMY

    >gi|120402805|ref|YP_952634.1| glutaredoxin-like protein [Mycobacterium vanbaalenii PYR-1]
    MSADEATLTMYTTTWCGYCTRLKMALKSEGIRWNEVDIEAEPAAAEFVGSVNGGNHVVPTVKFADGSTLTNPSIKQVKAK
    LAG

    >gi|120402828|ref|YP_952657.1| rhodanese domain-containing protein [Mycobacterium vanbaalenii PYR-1]
    MERYPPRYHASRGFRHQQLRKGLTSMTAPATIDSHDLHQMLGSATPPRVLDVRTPGEFETAHINGAYNVPLDLLREHRDE
    IIGHLDQDVVLV
    CRSGQRAAQAEETLRNTGLTNVHILDGGITAWEAQGFAVNRGATRWDLERQVRLVAGSLVLSAILGSI
    AAPKLKWLAAGVGGGLTFAAVSNTCAMGMLLSKLPYNRGTATCDAQTVVAQLVDANTTDKNKKVS

    >gi|120402829|ref|YP_952658.1| beta-lactamase domain-containing protein [Mycobacterium vanbaalenii PYR-1]
    MKFIQYYLDCLSHASYLIADETTGRAVVVDPQRDVAEYLADATEFGYTIELVIETHFHADFLSGHLELAKATGAKIVYSS
    VAETEFESMGVADGQIYSLGEVTLKFLHTPGHTPESLSIVVYEHAGDEVPYGVLTGDALFIGDVGRPDLLASIGFTREEL
    ADKLYDSLHTKLMTLPDATRVYPAHGAGSACGKNLSTDLWSTMGEQKATNYALRAPDKATFMELVTEGQPPAPSYFVYDA
    ILNRKDRELLDETKMPEAMSYEQVRDAVKAGAVLVDGRNPEEFALGHLRGAVNIGLEGRYAEFAGSVVPTDVDIVLFTEP
    GQELEGKTRLARIGFDRVIGYLERPFEAMLDHQDEVQVASRLTAKAFDARAAELADLQIVDVRNPGEVAAGMIPDAVSIP
    VGQLPARLGELDPAKPTVVY
    CAGGYRSSVAASLLRAHGFADVSDILGGYGAWDEAHQNA

    >gi|120402831|ref|YP_952660.1| thioredoxin [Mycobacterium vanbaalenii PYR-1]
    MATTSLTYDDFESTIRTNPIVLVDFWASWCGPCRSFAPVFDRSSQTHPDVVHAKVDTQHERDLAATLEITSIPTVMAFRD
    GVLVYRQPGAMHPAALEDLITRVKALDMNDVHAKIAARKSEAHTG

    >gi|120403034|ref|YP_952863.1| glutaredoxin-like protein NrdH [Mycobacterium vanbaalenii PYR-1]
    MTQPASVTVYTKPACVQCNATYKALDKQGIAYDVVDISLDNEARDYVMALGYLQAPVVVAGNDHWSGFRPDRIKALAGVA
    ATA

    >gi|120403210|ref|YP_953039.1| alkylhydroperoxidase [Mycobacterium vanbaalenii PYR-1]
    MTARTLLSSAVPNAYQTMITLSGQADKAALDAGVDPLTLELVRIRASQLNGCGFCLRLHVRDALAKGETTDRLAVLPAWR
    ETDYFTPAERAALAIAEEITGIGTRAAGIDDDTAAVDGQQAAALRWVAIAINAFNRIAISSRYTIKP

    >gi|120403289|ref|YP_953118.1| mycothione/glutathione reductase [Mycobacterium vanbaalenii PYR-1]
    MADFDIAIIGTGSGNSILDERYVDKRVAICEEGVFGGTCLNVGCIPTKMFVYAAGVAHDIRESSRFGVDSHIDDVRWTDI
    VSRVFGRIDPLASGGEHYRRSSPNVEVFASHARFVPGSGDGYRLCTADGDEFTAEQVVIAAGARATVPPAIADCGVKFHT
    SDTIMRISELPEHLVIVGGGFVAAEFAHVFSSLGSRVTIVLRGTTMLSHCDDTVCERFTDIAGKKWEIRSRRNVVGGQSD
    ESGLTLRLDDDSTVHADALLVATGRVPNGDLLDAHHAGVEVADGLVVVDEFQRTTARNIFALGDVSSPYQLKHVANHEAR
    VVRHNLLQGWDDTENLMPANHRNVPSAVFTEPQIACVGLTENEARSAGYRIRSKVQDYGDVAYGWAMEDSTGFAKLIVDD
    DTGLLLGAHIMGHQASSIIQPIVQAMAFDLPAQDMARGQYWIHPALPEVVENALLALCGEPPWPPSKRH

    >gi|120403438|ref|YP_953267.1| soluble pyridine nucleotide transhydrogenase [Mycobacterium vanbaalenii PYR-1]
    MASKLEYDLVVIGSGPGGQKAAIAAAKLGKTVAVVERGRMLGGVCVNTGTIPSKTLREAVVYLTGMSQRELYGTSYRVKE
    KITPADLLARTTHVISREQDVVRSQLMRNRVDLVQGHGRFLDAHTVLVEEPHRGERTTLTGEHIVIATGTKPARPAGVEF
    DEERVLDSDGILDLKTLPTSMVVVGAGVIGIEYASMFAALGTKVTVVEKRGSMLEFCDPEIVESLKFHLRDLAVTFRFGE
    EVTGVDVGAAGTVTTLASGKQIPAETVMYSAGRQGQTDHLDLASAGLEADDRGRIFVDDNYQTKVDHIYAVGDVIGFPAL
    AATSMDQGRLAAYHAFGEPTQGMTELQPIGIYSIPEVSYVGATEVELTKNAIPYEVGVSRYRELARGQIAGDSYGMLKLL
    VSTEDLRLLGVHIFGTSATEMVHIGQAVMGCGGTVEYLVDAVFNYPTFSEAYKVAALDVMNKLRALSQFRS

    >gi|120403476|ref|YP_953305.1| methionine-R-sulfoxide reductase [Mycobacterium vanbaalenii PYR-1]
    MTGPKLVLSDDQWRERLTPQEFAVLRQAGTERPFTGEYTDTKTDGVYQCRACGAELFRSSEKFESHCGWPSFFDPADSDA
    VLLRPDDSLGMRRVEVLCANCHSHLGHVFEGEGYPTPTDQRY
    CINSISLRLVPSQS

    >gi|120403484|ref|YP_953313.1| methylated-DNA--protein-cysteine methyltransferase [Mycobacterium vanbaalenii PYR-1]
    MSINMFDVTEADDADTLARLHGRLTAAADADGLLDVAYRTIDSPVGSLLLAATPVGVVRVAFDVEIHDAVLARLAETLSP
    RILYAPHRLDAVARQLDEYFAKQRTTFDVPVDLRLADGFRRSVVEHLRDIGYGRRESYAQVAAAIGSPRAVRAVGTACAH
    NPLPVVIP
    CHRVVRSDGTIGQYVGGPHAKTALLDLEAVRE

    >gi|120403724|ref|YP_953553.1| thioredoxin [Mycobacterium vanbaalenii PYR-1]
    MATRDITAQEFNDTINDNDIVLVDFWASWCGPCKAFAPTFAASSEKHPDVVYAKVDTEAEQQLAAAADIRSIPTLMAFKK
    GKLVFNQAGALPPAALEDLIQQVKDFDIDAAIAAQDNGQG

    >gi|120403797|ref|YP_953626.1| redoxin domain-containing protein [Mycobacterium vanbaalenii PYR-1]
    MAEFELPDQTGTTRTLTGLLADGPVVLFFYPAAMTPGCTKEACHFRDLAAEFAAVGATRVGISADPVDKQAKFADQQKFD
    YPLLSDTEGVVATQFGVKRGLLGKFMPVKRTTFVIDTDRTVLEVIASEFSMDTHADKALEVLRGRQSA

    >gi|120403953|ref|YP_953782.1| thiol peroxidase [Mycobacterium vanbaalenii PYR-1]
    MAQITLRGNPINTVGELPSVGSAAPGFTLTGTDLGTVGDDQFRGKPLLLNIFPSIDTPVCAASVRRFNESAASAGVSVLC
    VSKDLPFAQKRFCGAEGIENVTTASAFRDGFGDDFGVTITDGPMAGLLARAVVVVGADGNVAYTELVPEIGQEPDYDAAL
    AALRS

    >gi|120403997|ref|YP_953826.1| uncharacterized peroxidase-related enzyme [Mycobacterium vanbaalenii PYR-1]
    MTATADAPVQAPATISRLAVPELDELRSPGVRGFFNRQLRDEGLTSNWFRALSLNEGDLERLNAYLLPLLGTDGRGGLSA
    REREVIATVVSGENRCAY
    CHTNHANKLGKVAGDWSFGQRVAIDHHQVAELTERERALADLAVAVNSDPQSIRDSDIVRLR
    DLGLDDHEILEGISIAAFIGATNRIGIALSVPPNPEYTGIPAGRGHTTA

    >gi|120404214|ref|YP_954043.1| DSBA oxidoreductase [Mycobacterium vanbaalenii PYR-1]
    MNMKGLGSILANTRVLLTVFVIAVAMVGTVVFLSVRDKDSAPDIALDGSPAGQTVRENSHRLNSVPDSEVYFVEFLDFEC
    EGCRALYPAVEQLRAEYGDRVNFVLRYFPLRSHFNAERAARAVEAAAQQGQLEAMYRKMYETQAQWGEKQIPADDVFRGF
    AQQLGLDMEAFDATYNDPATLERIQLDIADGTALGVQGTPTFFINDERIQPRSYDDLTTALDQALERG

    >gi|120404217|ref|YP_954046.1| redoxin domain-containing protein [Mycobacterium vanbaalenii PYR-1]
    MTSLRRSVAVVAALVVATASVTGCTTGEDAVAQGGTFDFVSPGGKTAIFYDPPSTRGTIGNLSGPDLFTDEPIRLSDFTG
    KVVLINVWGSW
    CAPCRTETPELETVYGEYRDRGVQFLGIDVRDNRDTARDFVTDRNVQYPSIFDPAMRSLITLGRSYPTS
    VVPTTMVLDRQHRVAAVYLMALLAEDLRPLLDRLTTER

    >gi|120404440|ref|YP_954269.1| mercuric reductase [Mycobacterium vanbaalenii PYR-1]
    MSAQHFDAIIVGAGQAGPPLAGRLTAAGQTVAVIERKLVGGTCVNYGCIPTKTLVASAHAAHLARRGNDFGVAAAGVTVD
    MAAVKARKDRISVGDREGLESWLAGMKGCTLIRGHARFENPHTLRVDDQLLEADRIFLNVGGRAVAPDMPGLADVDYLTN
    VGILDLDEVPEHLVVIGGSYIALEFAQMYRRFGAAVTVIERGPRLTAREDEDVSAAIKEILEAEGIDVVVGADAISFAKQ
    ADGFTVTPRAGAEPIGGSHLLVAVGRRPNTDDLNLEAAGVQTDSRGYIVVDDQLRTSADNIWAMGDCNGRGAFTHTSYND
    FEIVAANLLDDDPRRVSDRVTTYALYIDPPLGRAGMTVEEVRRSGRKALVGKRPMTRVGRAVEKGETQGFMKVVVDAETD
    EILGAAILGVGGDEVVHLILDVMTAKLPYTAISRTMHIHPTVSELIPTVLQELKPLA

    >gi|120404539|ref|YP_954368.1| iron-sulfur cluster assembly accessory protein [Mycobacterium vanbaalenii PYR-1]
    MTVQDESAVQAGQTTEAQHGVTLSDAAAAKAKALLDQEGRDDLALRIAVQPGGCAGLRYNLFFDDRSLDGDLTVDFGGVA
    LTVDRMSAPYVQGATIDFVDTIEKQGFTIDNPNATGSCACGDSFN

    >gi|120404584|ref|YP_954413.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Mycobacterium vanbaalenii PYR-1]
    MDKLWDCVIIGGGAAGLSAALVLGRARRRTLVVDAGAQSNLAATGIGGLLGFDGVPPGQLYAQGRSQLAAYPSVEVRDGE
    VVTGAASDGGFTLELADGGVVQARRVLLAMGMRYEAPSLPGLAELWGRSVFH
    CPFCHGWEVRDRPLAVLANGERATHMAT
    LLRGWSDDVVLLTGGPAELTDTDRSRLADAGAAVDERAVSHLVSAGGELAAVVFADGTSLGRRGLLVAVTLHQRSALAAK
    LGVSFAAPGPVSVEAIEIDATHRTSVPGVFAAGDACVQMPQVAAAIAAGSAAAASIVASFQEER

    >gi|120404634|ref|YP_954463.1| heavy metal translocating P-type ATPase [Mycobacterium vanbaalenii PYR-1]
    MSLPNHIVGVDQPHSIELSIGGMTCASCAARIEKKLNKIDGVEASVNYATEKAKVDYPNSVDPAVLIAAVEATGYTATAP
    AAPNDAAPTDSGPDAGEADSLRSRLLISLVLTVPVIAMSMIPALQFTNWQWLALTLASPVVVWGALPFHRAAWANARHRA
    ATMDTLISLGVSAAYLWSLWALFIGHAGMPGMRMAFSLLPDAGSETEHIYLEVAAAVTVFILAGRYFEARAKTRSGAALR
    ALLDMGAKDVAVVRNGTEIRIPTAELSVGDVFVVRPGEKIATDGVVTDGSSAVDASMLTGESVPVEVRPGDHVTGATVNA
    GGRLLVRATRIGADTQLAQMARLVEDAQNGKASVQRLADRVSAVFVPIVLALSVATLAAWLLTGHSATVAFTAAVAVLII
    ACPCALGLATPTALMVGTGRGAQLGILIKGPQVLESTRRVDTIVLDKTGTVTTGRMSLVGVHPGAGQNSDELLEFAGALE
    SASQHPIAEAIAASAAAGGTLPAVEDFSNHNGYGVTGVVAGHAVLVGRLSWLTDDWSLTAPDDLTSAAEHAQSQGHTPVW
    VAWDGAVRGVIVVADTVKGTSADAIGQFRKLGLRPFLLTGDNRRAALAVAAEVGIDPDDVIAEVLPADKVDTIKCLQAQG
    RTVAMVGDGVNDAAALVQADLGLAMGTGSDVAIEASDLTLVRGDLRAAADAIRLARSTLRTIKGNLFWAFAYNVAALPLA
    ALGLLNPLIAGAAMAFSSVFVVSNSLRLRRFTSSASPGQTEDVHVATVPPGGDEYRRAHTAP

    >gi|120404653|ref|YP_954482.1| DSBA oxidoreductase [Mycobacterium vanbaalenii PYR-1]
    MAPLTRILLTVFAVITMIIGVGVYLSAQDKDTPGSAQAQGGDVGQLVRENSRRLTNVPNSDVTFVEFLDFECEACRAAFP
    MVEQLRAEYGDRVNFVIRYFPIQSHFNAERAARAVEAAAQQDKFEPMYKKMYETQSEWGEQQTPADSRFRGFAAELGLDM
    AAFDAAYNDPATLDRVNVDVADGKALGVQGTPTFFLDGTEVEFRSYDDLKTAVEQALNG

    >gi|120404672|ref|YP_954501.1| redoxin domain-containing protein [Mycobacterium vanbaalenii PYR-1]
    MGIERWRRRRPPTRWLLVIRRGIAAGLSAVLFGAAVSGCSSGDDAVAQGGTFEFISPGGQVDIFYDPPQSRGRPGPIRGP
    DLMDPNRTLSLDDFAEQVVVINVWGQW
    CGPCRTEMPELQRVYDATRNEGVAFLGIDVRDNNRQAAVDFIVDRNVTFPSIY
    DPPMRTMIALGARYPTTVIPSTIVLDRSHRVAAVFLRALLAEDLEPVVRRLAAETATG

    >gi|120404708|ref|YP_954537.1| redoxin domain-containing protein [Mycobacterium vanbaalenii PYR-1]
    MLSVGEPAPDFTLKDQNNQPVTLSGFRGAKNVLLVFFPLAFTGICQRELDEIRDRLGDFVNEETATLAISVGPSPTHKVW
    ATERGYTFPVLSDFWPHGEIARAYGVFNDASGFANRGTFVVDRSGIVAFAECKQPGEARDQAVWGQALNTLRSG

    >gi|120404975|ref|YP_954804.1| thioredoxin [Mycobacterium vanbaalenii PYR-1]
    MATTSLTYDDFESTIRTNPIVLVDFWASWCGPCRSFAPVFDRSSQTHPDVVHAKVDTQHERDLAATLEITSIPTMMAFRD
    GVLLYRQPGAMHPAALEDLITRVKALDMNDVHAKIAARKSEAHTG

    >gi|120404977|ref|YP_954806.1| beta-lactamase domain-containing protein [Mycobacterium vanbaalenii PYR-1]
    MKFIQYYLDCLSHASYLIADETTGRAVVVDPQRDVAEYLADATEFGYTIELVIETHFHADFLSGHLELAKATGAKIVYSS
    VAETEFESMGVADGQIYSLGEVTLKFLHTPGHTPESLSIVVYEHAGDEVPYGVLTGDALFIGDVGRPDLLASIGFTREEL
    ADKLYDSLHTKLMTLPDATRVYPAHGAGSACGKNLSTDLWSTMGEQKATNYALRAPDKATFMELVTEGQPPAPSYFVYDA
    ILNRKDRELLDETKMPEAMSYEQVRDAVKAGAVLVDGRNPEEFALGHLRGAVNIGLEGRYAEFAGSVVPTDVDIVLFTEP
    GQELEGKTRLARIGFDRVIGYLERPFEAMLDHQDEVQVASRLTAKAFDARAAELADLQIVDVRNPGEVAAGMIPDAVSIP
    VGQLPARLGELDPAKPTVVY
    CAGGYRSSVAASLLRAHGFADVSDILGGYGAWDEAHQNA

    >gi|120404978|ref|YP_954807.1| rhodanese domain-containing protein [Mycobacterium vanbaalenii PYR-1]
    MERYPPRYHASRGFRHQQLRKGLTSMTAPATIDSHDLHQMLGSATPPRVLDVRTPGEFETAHINGAYNVPLDLLREHRDE
    IIGHLDQDVVLV
    CRSGQRAAQAEETLRNTGLTNVHILDGGITAWEAQGFAVNRGATRWDLERQVRLVAGSLVLTAILGSI
    AAPKLKWLAAGVGGGLTFAAVSNTCAMGTLLSKLPYNRGTATCDAHTIVTQLVDANTTDKNKKVS

    >gi|120404982|ref|YP_954811.1| rhodanese domain-containing protein [Mycobacterium vanbaalenii PYR-1]
    MDVLEVDPTGATGLVDGSGAILLDVREDNEWSAGHAPGAVHVRLGDLDPRSFDTTSPVVAVCRSGNRSGSAAKKLAAAGV
    TVYNLVGGMKAWREAGRPVIRDDGSAGTVV

    >gi|120405010|ref|YP_954839.1| DsbA oxidoreductase [Mycobacterium vanbaalenii PYR-1]
    MSEKSRTDFWFDPLCPWAWITSRWVLEVEKVRDIEVNFHVMSLAVLNEGKDVPEAYREAMQKAWGPVRVAIAAEQAKGPE
    ILGPLYTAMGTRIHNQGYQGSDPDFSRVIRESLDEVGLPAELAEAATSTFYDVALRESHHAGMDAVGDDVGTPTIHVNGV
    AFFGPVLSRIPRGEDAGKLWDASVIFASYPHFWELKRSRTEAPVFD

    >gi|120405036|ref|YP_954865.1| methyltransferase type 12 [Mycobacterium vanbaalenii PYR-1]
    MQDYWNHNTAYHPWLVGIAGEHRGDVLDIGCGDGLLAQRLLPVSRSVTLIDPDPDSVARAQARLAGHADVSISQQSFHDY
    RPGTALFDVITFVASLHHMALRESLRKARALLRPGGELAVVGLSANRSASDWIWSGL
    CLPAVRIGSRLHRETRDIGVVVA
    QPRESLREIRLVSDDVIPGAVVRRALYYRYLLRWRKPA

    >gi|120405074|ref|YP_954903.1| redoxin domain-containing protein [Mycobacterium vanbaalenii PYR-1]
    MPQTPRLEVGDTAPAFSLPDADGNTVKLADYKGRKVIVYFYPAASTPGCTKEACDFRDSLGELNEAGLDVVGISPDKPEK
    LAKFRDAENLTFPLLSDPDRKVLEAWGAYGEKKMYGKTVQGVIRSTFVVDEKGKIAVAQYNIRATGHVAKLRRDLSV

    >gi|120405277|ref|YP_955106.1| methylated-DNA--protein-cysteine methyltransferase [Mycobacterium vanbaalenii PYR-1]
    MDNMRYRTMDSPVGLLTLAGSTGRLQHLRMVDQTYEPDRAGWEKDDSAFPEAVMQLQEYFRGERREFDLDLELAGTAFQR
    RVWEALLTIPYGETRSYGQIAQQIDAPGAFRAVGLANGHNPIGIVVP
    CHRVIGANGSLTGYGGGLDRKKMLLGMERKNSP
    TIPTLFD

    >gi|120405400|ref|YP_955229.1| heavy metal transport/detoxification protein [Mycobacterium vanbaalenii PYR-1]
    MSTTITVEGMSCAGCANSVRAELTHIPGVREVDVDISNGTVTIDSDNPVDPAAIREAVEEAGYTLAG

    >gi|120405401|ref|YP_955230.1| heavy metal translocating P-type ATPase [Mycobacterium vanbaalenii PYR-1]
    MNTIELSIGGMTCASCAARVEKKLNKLDGVTATVNFATEKARVAFGDEVSPGQLVSAVESAGYQAELPERPDEPAEPTDD
    PTAALKRRLLICVALSVPVIAMAMVPVLQFTYWQWLSLTLAAPVVVWGAWPFHQAAWTNLRHGTATMDTLISIGTLAALG
    WSIYALFWGTAGIPGMTHPFELTIARTDGTSNIYLEAAAGVTTFILAGRYFEARAKRRAGAALRALLELGAREVTVRRGG
    AEQRIPIEQLVIGDEFVVRPGEKIAADGTVVEGASAVDASMLTGESVPEEVQPGDQVVGATVNVDGRLVVRADRVGSDTQ
    LAQMARMVEDAQNGKAQAQRLADRISGVFVPIVIALSVATLGFWIGSGFPVAAAFTAAVAVLIIACPCALGLATPTALMV
    GTGRGAQLGILIKGPEVLEDTRRVDTVILDKTGTVTTGSMTLVDVFAAEGEQPDEVLRVAGAVESSSEHPIARAIAAGAQ
    EKFGELPAVTAFTNLRGLGVSGQVDGRAVLLGRLRLLADRSHEIPSELEVAVARAESDGRTAVVVGWDGQARGVLMVADA
    VKPTSAEAISLLKRLGLTPIMVTGDNEAVARAVAAEVGIDEVIAGVLPQDKVDTVKRLQRDGKVVAMVGDGVNDAAALAQ
    ADLGLAMGSGTDVAIEASDLTLVSNDLRAVPDAIRLSRKTLSTIKGNLFWAFAYNVAALPLAAAGLLNPMIAGAAMAFSS
    VFVVSNSLRLRAFTPSR

    >gi|120405617|ref|YP_955446.1| Fis family transcriptional regulator [Mycobacterium vanbaalenii PYR-1]
    MSRADGSTNSLARATSPYLRQHADNPVHWQQWAPDALALAAERDVPILLSIGYAACHWCHVMAHECFEDDEVAAAMNAGF
    VCIKVDREERPDLDAVYMNATVALTGQGGWPMTCFLTPDGRPFFCGTYYPKASFLQLLAAVVDTWRTRRADVEETSDKIA
    AELRSMASGLPRGGPPVAAEVCDDASAAVLRDEDTVDGGFGAAPKFPPSALLEALLRNHERTGSPAPLAAVSRACEAMAR
    GGIYDQLGGGFARYSVDAAWVVPHFEKMLYDNAQLLRVYAHWARRTGNPLAHRVVDETVRFLIEDLRVGGMFVSSLDADT
    AGVEGLTYVWTPGQLCEVLGEGDGRWAAELFGVTAAGTFEGGASVLQMRADPDDADRFVRVRDALRAARLTRPQPTRDDK
    VVTAWNGLAITALVEASVLDRPEYLSAAIQCARTLLDAHLVDGRLRRSSLGGVVGDSMAVLEDHAALATGLLALHQATGE
    RVWLQEATGLLDLALDHFSDSAEVGRWFDVADDAEQLMLRPSDPLDGATPSGASLIAEALQLAAHLAPEAAAQRYAAAAE
    ATMAGATVLLARVPRSAGHWLAVAEAAVRGPIQIAVAGGADSALLAAARRLAPGGAVVVGGEVNSSELLRDRPRVDGADA
    AYVCRGRVCDLPVTTVEDLATALGASV

    >gi|120405664|ref|YP_955493.1| glutaredoxin-like protein [Mycobacterium vanbaalenii PYR-1]
    MADSQASTSPQSSDRQAIEVYWRPGCPFCRRLMRALRGSGLTLREVNIWEDAEAAARVRSVADGNETVPTVFIGDRALVN
    PSSRQVFAAIGHQPPPRLWDRLRGR

    >gi|120405734|ref|YP_955563.1| arsenate reductase [Mycobacterium vanbaalenii PYR-1]
    MAGRIYHNPKCSTSRKTLDLLRDNGIEPEIVLYLKTPPTRAELAAMIADAGIDVRTAVRKRESLYTELDLASASDDELLD
    AMAEHPILIERPFVVTDKGTRLARPLDNVREIL

    >gi|120405741|ref|YP_955570.1| OsmC family protein [Mycobacterium vanbaalenii PYR-1]
    MTTTTTLNGIDREALSATLDAVRATPALAQVSFTLGSAWLSGCHQRSQTGEMRQNGEAVADRRSRYVLESDEPAALLGTD
    TAANPAEYVLQALAG
    CYAVTYATNAALRGIELSSLKLELEVDFDLHGFLGLDDSVRPGAQQIRVNVHAESPNASGEQLQK
    LTEAVQDHSPIRDTLANPVEVVTTLVR

    >gi|120406047|ref|YP_955876.1| thioredoxin domain-containing protein [Mycobacterium vanbaalenii PYR-1]
    MSSSWIAVIAVLIAAFGLAFVIGRLLTLRSGLIKGAAEWPALDDSDVDALGLSRTGPTVLHFSAVWCGPCAGVRRVVDQV
    CAELPEVTHVEIDLDADPESARKLSVLSLPTTFIFDADGRQRYRTSGVPTAADLRSALQPLLA

    >gi|120406049|ref|YP_955878.1| thiosulfate sulfurtransferase [Mycobacterium vanbaalenii PYR-1]
    MARSDVLVTADWAESNLEAPKTVFVEVDEDTSAYDTGHIPGAVRLDWKTDLQDPVKRDFVDAAQFSKLLSERGIANDDTV
    VLYGGNNNWFAAYAYWYFKLYGHQDVKLLDGGRKKWELDARPLSKDAVERPQTSYTAKEPDNSIRAFRDEVIAAIGTKNL
    VDVRSPDEFSGKILAPAHLPQEQSQRAGHIPTAINVPWSKAANEDGTFKSDEDLAKLYAEAGLDGEKETIAY
    CRIGERSS
    HTWFVLQELLGHKNVKNYDGSWTEYGSLVGAPIELGS

    >gi|120406082|ref|YP_955911.1| glutathione peroxidase [Mycobacterium vanbaalenii PYR-1]
    MTDTPLTEIALTTLDGRTTTLAELADGAALVVNVASKCGLTPQYGALEQLAKDYGPRGLTVIGVPCNQFMGQEPGTAEEI
    QTFCSTNYGVTFPLLEKAEVNGPNRHPLYAELTQTADDAGEAGDVQWNFEKFLLAPGGKVVKRIRPRTAPDDPEVIAAIE
    AVVPR

    >gi|120406263|ref|YP_956092.1| redox-active disulfide protein 2 [Mycobacterium vanbaalenii PYR-1]
    MIVKILGPGCRNCHALEEHTREALAQLGLDAEIEAVTDYAEIAGYGVMKTPGLVVDEEVVVAGKVPSVKDLTRLLAPR

    >gi|120406270|ref|YP_956099.1| 3-mercaptopyruvate sulfurtransferase [Mycobacterium vanbaalenii PYR-1]
    MTRADIFITAAELARLIAEGAPVNVLDVRWELTRPDGREAYTRGHVPGAVYVSLEDELSDHAVTGRGRHPLPSGDSVESA
    ARRWGLRRGVPTVVYDDWNRAGSARAWWVLTAAGIGGVRILDGGLAAWTAAGGRLETGVPAIDPGDVAVEFRDLYRGALP
    ALTAEDVTGFDGVLLDARAPERFRGDTEPVDRVAGHIPGARNAPSVETLSVDGTFLPDDELVRYFRGRGATEGGVGVY
    CG
    SGVTAAVTIAALRATGVEAKLFPGSWSQWSADASRPVATGE

    >gi|120406379|ref|YP_956208.1| redoxin domain-containing protein [Mycobacterium vanbaalenii PYR-1]
    MALVIVVALGAALWAELDADESQPRTQRDAISARDRRDADTPEALAGLRARAALEPCPTGGDAGPGPETLRGIELECVGD
    GSRVDVAEAVAGRPVVLNLWAYW
    CGPCADELPAMAEYQRRVGSAVTVLTVHQDENESAALLRLTELGVHLPTLQDGRRTI
    AAALQVPNVMPATVVLRADGSVAEILPRSFATADEIAAAVDPKIGAA

    >gi|120406500|ref|YP_956329.1| DSBA oxidoreductase [Mycobacterium vanbaalenii PYR-1]
    MSGSRRESVVKDLVFIGGLLILAVALIVYLVMGSEEVSDAASQPMSPQVSAPESNAPGGQVDAVTALSVERRTTGDPLAQ
    GDPAAPVVMVMFADYR
    CPFCAKFSRDTEPDLVERFVDQGVLRLEWRDMPIFGEQSMRAARAGRAAAEQGKFWEFNHEVFA
    MSPDRGHADLNEDALVGFAEKAGVPDIDKFAASMRGNEFDAAIDADLAQGSSIGVPSTPAFVINGEPVLGAQPTEEFVRV
    IDEAKDRT

    >gi|120406611|ref|YP_956440.1| rhodanese domain-containing protein [Mycobacterium vanbaalenii PYR-1]
    MDDTDVPQASIGDVPVDFDETVVLLDVREDDEWQRGHAPGAQHIPMGDVPARLAEIDTEAQLFVVCHAGGRSQRVAQYLA
    RNGYDPINVAGGMLAWAGAGRPVVTDGGDSGAI

    >gi|120406650|ref|YP_956479.1| methionine-R-sulfoxide reductase [Mycobacterium vanbaalenii PYR-1]
    MTQRYNKNPAAVDALSPEQYHVTQRNGTERPFTGEYWDNHEPGLYVDVVSGEPLFASVDKFDSGSGWPSFTRPIEKENVL
    EKRDFSHLMIRTEVRSAHGDSHLGHVFNDGPRDRGGLRY
    CVNSAALRFIHLDDLEAQGYGQYRGLFEATDKEQA

    >gi|120406651|ref|YP_956480.1| methionine sulfoxide reductase A [Mycobacterium vanbaalenii PYR-1]
    MSDHKRAVLAGGCFWGMQDLIRKQPGVVSTRVGYTGGQNDHPTYRNHPGHAEAIEIVYDPAQTDYRALLEFFFQIHDPTT
    KNRQGNDVGTSYRSEIFYVDDEQRRIALDTIADVDASGLWPGKVVTDVSPAPEFWEAEPEHQDYLERYPSGYTCHFPRPG
    WKLPKRAEV

    >gi|120406714|ref|YP_956543.1| hypothetical protein Mvan_5772 [Mycobacterium vanbaalenii PYR-1]
    MLQGRFVGELPELAVPWKAEAAPQPQLLVVNEPLAAELGVDADWLRGPDGLGLLTGTVVPSDATPAAQAYAGHQFGGYQP
    RLGDGRALLMGEFVDSTGRLRDLHLKGSGRTPFARGGDGLAAVGPMLREYVISEAMHALGIPTTRALAVVATGRPVYRDT
    VLPGAVLARVASSHLRVGTFQYAAAVSAREGNVDLLRRLADHAIARHHPAAAVAENRYLALLDAVSAAQAKLVAQWMLVG
    FVHGVMNTDNMTISGETIDYGPCAFMEAFDPATVFSSIDSSGRYAYGNQPAITLWNLARFAETLLPLIHENSGAAIALAE
    ASLDSFAGLYETAWTDGMRAKLGVPGAPAESVTPLIEQLLPQMQQSHVDYTLFYRLLAGAARGDAEPVRGEFIDLAAFDE
    WLGRWRALEPDPAVMDRVNPVYIPRNHLVEDALTAATGGDLGPLQQLLTAVTAPFEERPGSERFAEPGEKEFSASFQTF
    C
    GT

    >gi|120406777|ref|YP_956606.1| beta-lactamase domain-containing protein [Mycobacterium vanbaalenii PYR-1]
    MDISIIETSGLGDRSYLISHGGSAVVIDPQRDIDRVLALADERATRITHVLETHLHNDYVTGGLELSRTVGAEYVVPAVD
    GIGYPHRAVTDGDVIDAGPMRFEVLHTPGHTHHHVSYVLRDDTGAVHGVFTGGSMLFGTTGRTDLVAAEDTEELTHAQFH
    SVRRLADTLPTDTPVYPTHGFGSFCSATPASGDESTIGEQRQSNPALTQDEQSYVDELLAGLSAYPTYYAHMGVINREGP
    APVDLTPPAPIDPAELRRRIEAGEWVVDLRNRTAFAAGHLQGTLGFELSGSFVSYFGWLYEWGAPVTLIGESPDQIAEAK
    RELVRIGVDRLTGSATGDVDTLRAEAPLGSYEVGDFARLARERKTTAVAVLDVRQTNEFDQEHIPGAVSIPLHELPQRLD
    DVPAGPVWVH
    CASGYRSSIAASYLDRAGISVVLIDDDFDNAVKLGLTVSG

    >gi|120406846|ref|YP_956675.1| thioredoxin [Mycobacterium vanbaalenii PYR-1]
    MTITNVKCRHCGTVNRLPAAANGTPRCAKCKNPLPWIAVAGDDDFAEVVERSKVPVLVDLWATWCGPCRMVSPALEQLAA
    ERAGKLKLVKVDVDSARQTAARFSVQAVPTLLVIAGGTVLARQAGAAPVAALRTWLDQTLTRPR

    >gi|120406996|ref|YP_956825.1| thioredoxin reductase [Mycobacterium vanbaalenii PYR-1]
    MTSSETIHDVIVIGSGPAGYTAAIYAARAQLNPLVFEGSQFGGALMTTTEVENYPGFRNGITGPELMDEMREQALRFGAD
    LRMEDVDAVDLTGPVKSVTVGDETFRARAVILAMGAAARHLGVPGEDTLLGMGVST
    CATCDGFFFRDQDIAVVGGGDSAM
    EEATFLTRFARSVTLIHRRDEFRASKIMLERAQANEKITFLTNTQVTAIEGDPKVTGIRLRNTATGEESTLPVTGVFVAV
    GHDPRSELVRDQVEVDDAGYVKVQGRTTYTSVEGVFAAGDLVDHTYRQAITAAGSGCAASIDAERWLAEHTEPGERSSTT
    TDDSDLIGAQQ

    >gi|120406997|ref|YP_956826.1| thioredoxin [Mycobacterium vanbaalenii PYR-1]
    MSDSKNTVTVTDDSFSDDVLSSGTPVLVDFWATWCGPCKMVAPVLEEIASEKAGSLTVAKIDVDENPATARDFQVVSIPT
    MILFKDGKPVKRIVGAKGKAALLRELSEVV

    >gi|120406566|ref|YP_956395.1| alkylhydroperoxidase [Mycobacterium vanbaalenii PYR-1]
    MNHLRGPVGASVEDMTQTLTTQDRLKIYKASPELYDAMMTLSTAAAKDVDPELAELIKIRASQLNHCAFCLDMHTRDARK
    AGVGEQKLDVLAAWTEAGELFGERERAALALTEAVTELGRDGVPDDVYARAAAVFSDRELGQVIAMVVTINAWNRINVAV
    RMPIPRR

    >gi|120403155|ref|YP_952984.1| hypothetical protein Mvan_2163 [Mycobacterium vanbaalenii PYR-1]
    MATKPKKNARYDLKAADRKRNLLVQIGLTAVVVIFAVTLVLYIVLSADDKPTAGESRAIRVESTSVIKKDGTDEPKAVLS
    MYEDFL
    CPHCGAFEQQFGPTISKLIDSGAIAADYYMVGILDRSQNQNYPSRAGGAAYCVADESVDAFRRFHAALYAQQPS
    EAGSAYPDNARLIEVARQSGAAGAVPECINKGTYVDMVAGLASATGVKSTPSVRINGEDYQYSTPEALVTKIKEIVGDVP
    GLEAAPPAPAPQPAPAS