Mycobacterium leprae TN uid57697

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|15827132|ref|NP_301395.1| putative antioxidant protein [Mycobacterium leprae TN]
    MTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCTKQACDFRDNLHDLNDAGLDVVGISPDPLTK
    LAEFRDAEALTFPLLSDHDCKVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAKLRRDLSLLEC
    C

    >gi|15827305|ref|NP_301568.1| putative thiosulfate sulfurtransferase [Mycobacterium leprae TN]
    MPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVGHIPGAVKVDWHTDLNDPKVRDYITGEQFAD
    LMNRKGIARDDTVVIYGDKSNWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPVVNRNDAPIRA
    FKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLRAGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDK
    TIVY
    CRIGERSSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV

    >gi|15827360|ref|NP_301623.1| molybdopterin biosynthesis-like protein MoeZ [Mycobacterium leprae TN]
    MSTSSTSLPPLVEPAGQLSRDEVIRYSRHLIIPDIGVDGQMRLKSARVLVIGAGGLGAPVLLYLAAAGVGTIGIIDFDVV
    DESNLQRQIIHGVADVGRSKAQSARDSIVAINPLVQVRLHEFRLESSNVVNLFKQYDLIVDGTDNFATRYLINDAAVLAK
    KPYVWGSLYRFEGQVSVFWEDAPDGLGLNYRDLYLEPPPPGMVPS
    CAEGGVLGIVCASIASVMGTEAIKLITGIGAPLLG
    RLMIYNALEMSYRRIRIHKDPSRPKITELTDYQQFCGVVSDDAAQVATGSIVTPRELRELLDSGKKLALIDVREPVEWDI
    VHIDGAQLIPRSLINSGEGLAKLPQDRMSVLY
    CKTGVRSAETLATVKKAGFSDAVHLQGGIVAWAKQVQPDMVIY

    >gi|15827394|ref|NP_301657.1| hypothetical protein ML0871 [Mycobacterium leprae TN]
    MAVQNELSAKTHGVILTDVAATKAKSLLDQEGRDDLALRIAVQPGGCAGLRYNLFFDDRTLDGDLTAEFGGVTLTVDRMS
    APYVEGASIDFVDTIEKQGFTIDNPNANGSCACGDSFN

    >gi|15827582|ref|NP_301845.1| methylated-DNA-protein-cysteine methyltransferase [Mycobacterium leprae TN]
    MIHCRSMDSPIGPLILAGHGSVLTNLQMVDQTYEPSRVGWLPENGAFAEAVSQLDAYFAGELTEFAIELDLCGTEFQQRV
    WQALLTIPYGETRSYGEIAEQVGAPGAARAVGLANSRNPIAIIVP
    CHRVIGASGQLIGYGGGLNRKLTLLELEKHQVLTS
    LTLFD

    >gi|15827586|ref|NP_301849.1| hypothetical protein ML1159 [Mycobacterium leprae TN]
    MAGAVDLSGLKQRARQKASTSDPASRATLGARGTGSSENTSVIEITEANFEDEVLVRSHEVPILVLVWSPRSDACVKLLE
    TLSGLAVADSGTWLLATVNVDAVPRVAQIFGVDAVPTVVALAAGQPLSSFQGMQSVDQLRRWLDSLLSVTAGKLRGPTRS
    EDSAEIDPAIAQARQQLEAGDFLTAKQSYHAILDADPASVEAKAAIRQIDFLTRATAQHPDAVAVADAAPGDIAAAFAAA
    DVQILNQDVTAAFERLIVLVRSTSGDERSSVRTRLIELFELFDPDDPNVIVGRRNLANALY

    >gi|15827745|ref|NP_302008.1| hypothetical protein ML1418 [Mycobacterium leprae TN]
    MAIESTMPALGTPAPSFMLFEPASGAMISLDELTGRALVVTFICNHCPYVQHVAAGLAILGRDLADQGVAIVGISSNDVI
    TYPQDGPDQMVAEARRHGWTFPYLYDETQAVARAFAASCTPDTFVFDGERRLVYRGQLDDSRPNNNLPVTAADVRAAVDA
    VLARRPVDSDQRPSIGCGIKWR

    >gi|15827781|ref|NP_302044.1| hypothetical protein ML1485 [Mycobacterium leprae TN]
    MPEKASVKYQADLWFDPLCPWCWITSRWILEVEKVRDVEVHFHVMSLAILNENREDLTENYLENITKAWGPARVVIAAEQ
    ANGASVLDPLYTAMGIRIHNEDNKNLDEVIKRSLADTGLPAELAAAAQSNAYDDALRESHHAGMDPVGDDVGTPTVHVNG
    VAFFGPVLSKIPRGEEAGKLWDASLTLAAYPHFFELKRTRTEPPQFA

    >gi|15827934|ref|NP_302197.1| glutaredoxin electron transport component of NrdEF [Mycobacterium leprae TN]
    MMNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYLQAPVVVAGNNHWSGFRPDRIKALAGAVLTA


    >gi|15827974|ref|NP_302237.1| thioredoxin [Mycobacterium leprae TN]
    MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPTFHASSNKHSDVVHLNVDTKAERQLALAAQI
    RSIPTLVAFKKGKPLLSQAGDLTPAVPGYLVQQIKAFDVSDDGVVPDEQV

    >gi|15828087|ref|NP_302350.1| cation-transporting ATPase [Mycobacterium leprae TN]
    MTASLVEDTNNNHESVRRIQLDVAGMLCAACASRVETKLNKIPGVRASVNFATRVATIDAVDVAVDELRQVIEQAGYRAT
    AHAESAVEEIDPDADYARNLLRRLIVAALLFVPLADLSTMFAIVPTNRFPGWGYLLTALAAPIVTWAAWPFHRVALRNAR
    YRAASMETLISAGILAATGWSLSTIFVDKEPRQTHGIWQAILHSDSIYFEVAAGVTVFVLAGRFFEARAKSKAGSALRAL
    AARGAKNVEVLLPNGAELTIPAGELKKQQHFLVRPGETITADGVVIDGTATIDMSAITGEARPVHASPASTVVGGTTVLD
    GRLVIEATAVGGDTQFAAMVRLVEDAQVQKARVQHLADRIAAVFVPMVFVIAGLAGASWLLAGASPDRAFSVVLGVLVIA
    CPCTLGLATPTAMMVASGRGAQLGIFIKGYRALETINAIDTVVFDKTGTLTLGQLSVSTVTSTGGWCSGEVLALASAVEA
    ASEHSVATAIVAAYADPRPVADFVAFAGCGVSGVVAEHHVKIGKPSWVTRNAPCDVVLESARREGESRGETVVFVSVDGV
    ACGAVAIADTVKDSAADAISALCSRGLHTILLTGDNQAAARAVAAQVGIDTVIADMLPEAKVDVIQRLRDQGHTVAMVGD
    GINDGPALACADLGLAMGRGTDVAIGAADLILVRDSLGVVPVALDLARATMRTIRINMIWAFGYNVAAIPIASSGLLNPL
    IAGAAMAFSSFFVVSNSLRLSNFGLSQTSD

    >gi|15828102|ref|NP_302365.1| alkyl hydroperoxide reductase [Mycobacterium leprae TN]
    MSLLSIGQQFPAYQLTALIGGDLSKVDAQQPGDYFTTVSSDSHPGKWRVVFFWPKDFTFICPTEIAAFGKLNEEFEGRGA
    QILGVSIDSEFVHFQWRAQHEDLKRLPFPMLSDIKRELSAASGALNADGVADRVTFIVDPDNDIQFVSVTAGSVGRNVEE
    VLRVLDALQSDQLCACNWRKGDPTLNATELLKTSA

    >gi|15828175|ref|NP_302438.1| thiredoxin [Mycobacterium leprae TN]
    MMTAIVATITVGMLTAFTGRWLTRHSGNVHEICSGPGQGTGTDTADLGLSRTGPTIVHFSAPWCGPCDRVRRVVYQVCKD
    LPDVAHIEIDLDTNPAAVRRFSVLSLPTTLIFDTDGQQRYRTSGVPKAFDLLSTLEPLLA

    >gi|15828177|ref|NP_302440.1| thiosulfate sulfurtransferase [Mycobacterium leprae TN]
    MARSDVLVSADWAESNLDSANIVFVEVDEDTSTYDGDHIAGAIKLDWRADLQDPIKRDFIDTQQFSKLLGDRGISNDNTV
    ILYGGNNNWFAAYAYWYFKLYRHDKVKLLDGGRKKWELDGRPLSTDTVTRPATSYAAAAPDNTIRAFRDEVIASIKIKNL
    VDVRSPDEFSGKLLAPAHLPQEQSQRPGHIPSAINIPWSKAANEDGTFKSDEQLAKLYADAGLDRLKETIVY
    CRIGERSS
    HTWFVLRELLGYQNVKNYDGSWTEYGSLVGVPIELGS

    >gi|15828232|ref|NP_302495.1| hypothetical protein ML2300 [Mycobacterium leprae TN]
    MKTLTPKTCGTIVVLAVVVALVAALVGQLRDNARTIEMTQATIEREHRDADTPAALAGPREHANLPPCPDAGSGPGPAVL
    RGVVLECASDGFAVDVARALAGRRVVLNLWASW
    CASCLGELPAMVEYQRRVGSDVMVVTVHQDENEMAALLRLAQLGVRL
    PTLQDGRRRVAAAFGVANVIPTTVVLRPDGSVAQTLPRALVSVDQIAAAVGNDTG

    >gi|15828281|ref|NP_302544.1| dihydrolipoamide dehydrogenase [Mycobacterium leprae TN]
    MTHYDVVVLGAGPGGYVAAIRAAQLGLSTAVVEPKYWGGICLNVGCIPSKVLLHNAELAHIFTKEAKTFGISGDASFDYG
    IAYDRSRKVSEGRVAGVHFLMKKNKITEIHGYGRFTDANTLSVELSEGVPETPLKVTFNNVIIATGSKTRLVPGTLLSTN
    VITYEEQILTRELPDSIVIVGAGAIGIEFGYVLKNYGVDVTIVEFLPRAMPNEDAEVSKEIEKQFKKMGIKILTGTKVES
    ISDNGSHVLVAVSKDGQFQELKADKVLQAIGFAPNVDGYGLDKVGVALTADKAVDIDDYMQTNVSHIYAIGDVTGKLQLA
    HVAEAQGVVAAEAIAGAETLALSDYRMMPRATFCQPNVASFGLTEQQARDGGYDVVVAKFPFTANAKAHGMGDPSGFVKL
    VADAKYGELLGGHMIGHNVSELLPELTLAQKWDLTATELVRNVHTHPTLSEALQECFHGLIGHMINF

    >gi|15828298|ref|NP_302561.1| hypothetical protein ML2412 [Mycobacterium leprae TN]
    MIAPATMQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFEFVSPDGKTDIFYEPPASRGRPGPLSGLDLA
    DPERTVALDDFTGNVVVINVWGQW
    CGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQVTFPSIYDPA
    MRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGDLQPVVARVAHETVAGQLPRGTS

    >gi|15828428|ref|NP_302691.1| methionine sulfoxide reductase A [Mycobacterium leprae TN]
    MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHGMHAEAVEIIYDPAITDYRTLLEFFFQIHDP
    TTRNRQGNDQGTSYRSAIFYLDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHYPNGYTCHFVR
    PNWKLPRRAPADAKADS

    >gi|15828461|ref|NP_302724.1| bifunctional thioredoxin reductase/thioredoxin [Mycobacterium leprae TN]
    MNTTPSAHETIHEVIVIGSGPAGYTAALYAARAQLTPLVFEGTSFGGALMTTTEVENYPGFRNGITGPELMDDMREQALR
    FGAELRTEDVESVSLRGPIKSVVTAEGQTYQARAVILAMGTSVRYLQIPGEQELLGRGVSA
    CATCDGSFFRGQDIAVIGG
    GDSAMEEALFLTRFARSVTLVHRRDEFRASKIMLGRARNNDKIKFITNHTVVAVNGYTTVTGLRLRNTTTGEETTLVVTG
    VFVAIGHEPRSSLVSDVVDIDPDGYVLVKGRTTSTSMDGVFAAGDLVDRTYRQAITAAGSGCAAAIDAERWLAEHAGSKA
    NETTEETGDVDSTDTTDWSTAMTDAKNAGVTIEVTDASFFADVLSSNKPVLVDFWATW
    CGPCKMVAPVLEEIASEQRNQL
    TVAKLDVDTNPEMAREFQVVSIPTMILFQGGQPVKRIVGAKGKAALLRDLSDVVPNLN