Mycobacterium leprae Br4923 uid59293

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|221229610|ref|YP_002503026.1| putative antioxidant protein [Mycobacterium leprae Br4923]
    MTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCTKQACDFRDNLHDLNDAGLDVVGISPDPLTK
    LAEFRDAEALTFPLLSDHDCKVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAKLRRDLSLLEC
    C

    >gi|221229783|ref|YP_002503199.1| putative thiosulfate sulfurtransferase [Mycobacterium leprae Br4923]
    MPLPTDPSPSLSAYAHPERLVTGDWLYFHLGKPGLAIVESDENVLLYDVGHIPGAVKVDWHTDLNDPKVRDYITGEQFAD
    LMNRKGIARDDTVVIYGDKSNWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRDTSLAVPNKTSTSYPVVNRNDAPIRA
    FKDDVLAILGTQPLIDVRSLDEYTGKCTEMPDSPEESVLRAGHIPTARSIPWEMTVDKSGRFRSSEELERLYDFITPNDK
    TIVY
    CRIGERSSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRVPITAGESPGAVPV

    >gi|221229838|ref|YP_002503254.1| molybdopterin biosynthesis-like protein MoeZ [Mycobacterium leprae Br4923]
    MSTSSTSLPPLVEPAGQLSRDEVIRYSRHLIIPDIGVDGQMRLKSARVLVIGAGGLGAPVLLYLAAAGVGTIGIIDFDVV
    DESNLQRQIIHGVADVGRSKAQSARDSIVAINPLVQVRLHEFRLESSNVVNLFKQYDLIVDGTDNFATRYLINDAAVLAK
    KPYVWGSLYRFEGQVSVFWEDAPDGLGLNYRDLYLEPPPPGMVPS
    CAEGGVLGIVCASIASVMGTEAIKLITGIGAPLLG
    RLMIYNALEMSYRRIRIHKDPSRPKITELTDYQQFCGVVSDDAAQVATGSIVTPRELRELLDSGKKLALIDVREPVEWDI
    VHIDGAQLIPRSLINSGEGLAKLPQDRMSVLY
    CKTGVRSAETLATVKKAGFSDAVHLQGGIVAWAKQVQPDMVIY

    >gi|221229871|ref|YP_002503287.1| hypothetical protein MLBr_00871 [Mycobacterium leprae Br4923]
    MAVQNELSAKTHGVILTDVAATKAKSLLDQEGRDDLALRIAVQPGGCAGLRYNLFFDDRTLDGDLTAEFGGVTLTVDRMS
    APYVEGASIDFVDTIEKQGFTIDNPNANGSCACGDSFN

    >gi|221230059|ref|YP_002503475.1| putative methylated-DNA-protein-cysteine methyltransferase [Mycobacterium leprae Br4923]
    MIHCRSMDSPIGPLILAGHGSVLTNLQMVDQTYEPSRVGWLPENGAFAEAVSQLDAYFAGELTEFAIELDLCGTEFQQRV
    WQALLTIPYGETRSYGEIAEQVGAPGAARAVGLANSRNPIAIIVP
    CHRVIGASGQLIGYGGGLNRKLTLLELEKHQVLTS
    LTLFD

    >gi|221230063|ref|YP_002503479.1| hypothetical protein MLBr_01159 [Mycobacterium leprae Br4923]
    MAGAVDLSGLKQRARQKASTSDPASRATLGARGTGSSENTSVIEITEANFEDEVLVRSHEVPILVLVWSPRSDACVKLLE
    TLSGLAVADSGTWLLATVNVDAVPRVAQIFGVDAVPTVVALAAGQPLSSFQGMQSVDQLRRWLDSLLSVTAGKLRGPTRS
    EDSAEIDPAIAQARQQLEAGDFLTAKQSYHAILDADPASVEAKAAIRQIDFLTRATAQHPDAVAVADAAPGDIAAAFAAA
    DVQILNQDVTAAFERLIVLVRSTSGDERSSVRTRLIELFELFDPDDPNVIVGRRNLANALY

    >gi|221230222|ref|YP_002503638.1| hypothetical protein MLBr_01418 [Mycobacterium leprae Br4923]
    MAIESTMPALGTPAPSFMLFEPASGAMISLDELTGRALVVTFICNHCPYVQHVAAGLAILGRDLADQGVAIVGISSNDVI
    TYPQDGPDQMVAEARRHGWTFPYLYDETQAVARAFAASCTPDTFVFDGERRLVYRGQLDDSRPNNNLPVTAADVRAAVDA
    VLARRPVDSDQRPSIGCGIKWR

    >gi|221230258|ref|YP_002503674.1| hypothetical protein MLBr_01485 [Mycobacterium leprae Br4923]
    MPEKASVKYQADLWFDPLCPWCWITSRWILEVEKVRDVEVHFHVMSLAILNENREDLTENYLENITKAWGPARVVIAAEQ
    ANGASVLDPLYTAMGIRIHNEDNKNLDEVIKRSLADTGLPAELAAAAQSNAYDDALRESHHAGMDPVGDDVGTPTVHVNG
    VAFFGPVLSKIPRGEEAGKLWDASLTLAAYPHFFELKRTRTEPPQFA

    >gi|221230411|ref|YP_002503827.1| glutaredoxin electron transport component of NrdEF [Mycobacterium leprae Br4923]
    MMNITVYTKPACVQCSATYKALDKQGIPYQTVDISLDSEARDYVMALGYLQAPVVVAGNNHWSGFRPDRIKALAGAVLTA


    >gi|221230451|ref|YP_002503867.1| thioredoxin [Mycobacterium leprae Br4923]
    MVREHGVGVRRWTRRDLIAEQLNETINVNNMVLVAFWASWCGPDRLFVPTFHASSNKHSDVVHLNVDTKAERQLALAAQI
    RSIPTLVAFKKGKPLLSQAGDLTPAVPGYLVQQIKAFDVSDDGVVPDEQV

    >gi|221230564|ref|YP_002503980.1| cation-transporting ATPase [Mycobacterium leprae Br4923]
    MTASLVEDTNNNHESVRRIQLDVAGMLCAACASRVETKLNKIPGVRASVNFATRVATIDAVDVAVDELRQVIEQAGYRAT
    AHAESAVEEIDPDADYARNLLRRLIVAALLFVPLADLSTMFAIVPTNRFPGWGYLLTALAAPIVTWAAWPFHRVALRNAR
    YRAASMETLISAGILAATGWSLSTIFVDKEPRQTHGIWQAILHSDSIYFEVAAGVTVFVLAGRFFEARAKSKAGSALRAL
    AARGAKNVEVLLPNGAELTIPAGELKKQQHFLVRPGETITADGVVIDGTATIDMSAITGEARPVHASPASTVVGGTTVLD
    GRLVIEATAVGGDTQFAAMVRLVEDAQVQKARVQHLADRIAAVFVPMVFVIAGLAGASWLLAGASPDRAFSVVLGVLVIA
    CPCTLGLATPTAMMVASGRGAQLGIFIKGYRALETINAIDTVVFDKTGTLTLGQLSVSTVTSTGGWCSGEVLALASAVEA
    ASEHSVATAIVAAYADPRPVADFVAFAGCGVSGVVAEHHVKIGKPSWVTRNAPCDVVLESARREGESRGETVVFVSVDGV
    ACGAVAIADTVKDSAADAISALCSRGLHTILLTGDNQAAARAVAAQVGIDTVIADMLPEAKVDVIQRLRDQGHTVAMVGD
    GINDGPALACADLGLAMGRGTDVAIGAADLILVRDSLGVVPVALDLARATMRTIRINMIWAFGYNVAAIPIASSGLLNPL
    IAGAAMAFSSFFVVSNSLRLSNFGLSQTSD

    >gi|221230579|ref|YP_002503995.1| alkyl hydroperoxide reductase [Mycobacterium leprae Br4923]
    MSLLSIGQQFPAYQLTALIGGDLSKVDAQQPGDYFTTVSSDSHPGKWRVVFFWPKDFTFICPTEIAAFGKLNEEFEGRGA
    QILGVSIDSEFVHFQWRAQHEDLKRLPFPMLSDIKRELSAASGALNADGVADRVTFIVDPDNDIQFVSVTAGSVGRNVEE
    VLRVLDALQSDQLCACNWRKGDPTLNATELLKTSA

    >gi|221230652|ref|YP_002504068.1| thiredoxin [Mycobacterium leprae Br4923]
    MMTAIVATITVGMLTAFTGRWLTRHSGNVHEICSGPGQGTGTDTADLGLSRTGPTIVHFSAPWCGPCDRVRRVVYQVCKD
    LPDVAHIEIDLDTNPAAVRRFSVLSLPTTLIFDTDGQQRYRTSGVPKAFDLLSTLEPLLA

    >gi|221230654|ref|YP_002504070.1| thiosulfate sulfurtransferase [Mycobacterium leprae Br4923]
    MARSDVLVSADWAESNLDSANIVFVEVDEDTSTYDGDHIAGAIKLDWRADLQDPIKRDFIDTQQFSKLLGDRGISNDNTV
    ILYGGNNNWFAAYAYWYFKLYRHDKVKLLDGGRKKWELDGRPLSTDTVTRPATSYAAAAPDNTIRAFRDEVIASIKIKNL
    VDVRSPDEFSGKLLAPAHLPQEQSQRPGHIPSAINIPWSKAANEDGTFKSDEQLAKLYADAGLDRLKETIVY
    CRIGERSS
    HTWFVLRELLGYQNVKNYDGSWTEYGSLVGVPIELGS

    >gi|221230709|ref|YP_002504125.1| hypothetical protein MLBr_02300 [Mycobacterium leprae Br4923]
    MKTLTPKTCGTIVVLAVVVALVAALVGQLRDNARTIEMTQATIEREHRDADTPAALAGPREHANLPPCPDAGSGPGPAVL
    RGVVLECASDGFAVDVARALAGRRVVLNLWASW
    CASCLGELPAMVEYQRRVGSDVMVVTVHQDENEMAALLRLAQLGVRL
    PTLQDGRRRVAAAFGVANVIPTTVVLRPDGSVAQTLPRALVSVDQIAAAVGNDTG

    >gi|221230758|ref|YP_002504174.1| dihydrolipoamide dehydrogenase [Mycobacterium leprae Br4923]
    MTHYDVVVLGAGPGGYVAAIRAAQLGLSTAVVEPKYWGGICLNVGCIPSKVLLHNAELAHIFTKEAKTFGISGDASFDYG
    IAYDRSRKVSEGRVAGVHFLMKKNKITEIHGYGRFTDANTLSVELSEGVPETPLKVTFNNVIIATGSKTRLVPGTLLSTN
    VITYEEQILTRELPDSIVIVGAGAIGIEFGYVLKNYGVDVTIVEFLPRAMPNEDAEVSKEIEKQFKKMGIKILTGTKVES
    ISDNGSHVLVAVSKDGQFQELKADKVLQAIGFAPNVDGYGLDKVGVALTADKAVDIDDYMQTNVSHIYAIGDVTGKLQLA
    HVAEAQGVVAAEAIAGAETLALSDYRMMPRATFCQPNVASFGLTEQQARDGGYDVVVAKFPFTANAKAHGMGDPSGFVKL
    VADAKYGELLGGHMIGHNVSELLPELTLAQKWDLTATELVRNVHTHPTLSEALQECFHGLIGHMINF

    >gi|221230775|ref|YP_002504191.1| hypothetical protein MLBr_02412 [Mycobacterium leprae Br4923]
    MIAPATMQSEAMRRSGATIIWRLANAGALLATLLAGCSGRDAVVQGGTFEFVSPDGKTDIFYEPPASRGRPGPLSGLDLA
    DPERTVALDDFTGNVVVINVWGQW
    CGPCRTEVTQLQQVYNATRDSGVSFLGIDVRDNNRQAAQDFVNDRQVTFPSIYDPA
    MRTLIAFGDKYPTTVIPFTLVLDRQHRVAAVFLRELLAGDLQPVVARVAHETVAGQLPRGTS

    >gi|221230905|ref|YP_002504321.1| methionine sulfoxide reductase A [Mycobacterium leprae Br4923]
    MARTNTRKAILAGGCFWGIQNLFRRQPGVISTRVGYTGGGTPNATYRNHGMHAEAVEIIYDPAITDYRTLLEFFFQIHDP
    TTRNRQGNDQGTSYRSAIFYLDDEQKKVALDTIAAVEASSLWPGKVVTEVSLAEDFWEAEPEHQDYLQHYPNGYTCHFVR
    PNWKLPRRAPADAKADS

    >gi|221230938|ref|YP_002504354.1| bifunctional thioredoxin reductase/thioredoxin [Mycobacterium leprae Br4923]
    MNTTPSAHETIHEVIVIGSGPAGYTAALYAARAQLTPLVFEGTSFGGALMTTTEVENYPGFRNGITGPELMDDMREQALR
    FGAELRTEDVESVSLRGPIKSVVTAEGQTYQARAVILAMGTSVRYLQIPGEQELLGRGVSA
    CATCDGSFFRGQDIAVIGG
    GDSAMEEALFLTRFARSVTLVHRRDEFRASKIMLGRARNNDKIKFITNHTVVAVNGYTTVTGLRLRNTTTGEETTLVVTG
    VFVAIGHEPRSSLVSDVVDIDPDGYVLVKGRTTSTSMDGVFAAGDLVDRTYRQAITAAGSGCAAAIDAERWLAEHAGSKA
    NETTEETGDVDSTDTTDWSTAMTDAKNAGVTIEVTDASFFADVLSSNKPVLVDFWATW
    CGPCKMVAPVLEEIASEQRNQL
    TVAKLDVDTNPEMAREFQVVSIPTMILFQGGQPVKRIVGAKGKAALLRDLSDVVPNLN